Entry information : ApruAPx-CcP03
Entry ID 12278
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ApruAPx-CcP03
Name ApruAPx-CcP03
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Aplosporella
Organism Aplosporella prunicola    [TaxId: 462254 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApruAPx-CcP03
start..stop
S start..stop
BfuAPx-CcP02 555 0 1..537 1..536
SsclAPx-CcP01 551 0 1..531 1..530
ApruAPx-CcP01 535 0 1..532 1..532
HC14APx-CcP02 533 0 1..534 1..542
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15358..15499 142 N° 2 13835..15303 1469  
complement(join(13835..15303,15358..15499))


exon

Literature and cross-references ApruAPx-CcP03
DNA ref. JGI genome:   scaffold_123 (15499..13835)
Cluster/Prediction ref. JGI gene:   303606
Protein sequence: ApruAPx-CcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   538 (518)
PWM (Da):   %s   58287.31 (56124.1)  
PI (pH):   %s   4.75 (4.66) Peptide Signal:   %s   cut: 20 range:20-537
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTSSLASIALLQFLRANADYTWPSKHDFLEDLISIQSGYIHEGFGDAVNPCGSSPDGHGRQSAAEWIRSAYHDMSTHDVNTGHGGMDGSIVLETARDENVGDAFNSTFGFMEIWHTSRSSMADLLAIGVKVASASCQGPEVAFRAGRIDATDLGVTGVPKPDQDLKTHTTKFANQGFNVSDMIAMVACGHAFGGVHGKDFPEITGDDSEDNFPHFTSTSVGGFDNRVVTDYLNGSSTNPLVVGKNETNNSDKRIFGADGNVTMQALADPATFMERCSDIFTRMIDTVPAAVTLSDVIDSLDVKPYGLQLSLNSDAKTLHFSGKIRIKTTKRDANDMSVSLAYRDRNGKSCNNCKIATTIAVLRGGQSYNWKDTFNWFEFDTTLDADTSISGFDVLITEAGKTETRDNNGHGYPVQDSILYQFDQSCLPQEADADGNWPLQVVAAIRKDSVSVPAVLEFAAKVPRQGSITPRLEVQSSKFEKIEGGEKGQYVLFKATQPVLPASWSSNMDLVLGKGDAEKMVEFQRTNEIGQECKA

Retrieve as FASTA  
Remarks complete sequence from genomics (1 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTTCATCGCTAGCGAGCATTGCTTTGTTGCAATTCCTTCGCGCCAATGCTGACTACACTTGGCCTTCTAAACATGATTTCCTTGAAGATCTCATAAGTATCCAGAGTGGCTAT
ATCCACGAAGGCTTCGGAGATG
GTAAGTGATTCTTCAAAGTAAATACACAGTCAAATCTGTTAACATTTCTCACAGCTGTCAACCCTTGCGGCTCATCCCCCGACGGACATGGCCGCCAG
TCGGCAGCAGAATGGATACGATCTGCTTACCATGACATGTCCACCCATGATGTCAACACCGGTCATGGAGGAATGGATGGGTCCATCGTTCTGGAGACAGCGCGCGATGAAAACGTCGGA
GACGCATTCAACAGTACCTTCGGTTTCATGGAGATTTGGCATACCTCGCGCTCTTCCATGGCAGACTTGCTCGCCATCGGCGTCAAGGTTGCATCCGCATCTTGCCAAGGCCCTGAAGTA
GCCTTCCGCGCTGGCCGCATCGACGCAACCGACTTGGGAGTTACGGGCGTGCCAAAACCCGATCAAGATCTCAAGACACACACGACCAAGTTCGCAAACCAGGGCTTCAACGTTAGTGAC
ATGATTGCCATGGTGGCATGCGGCCACGCCTTCGGCGGCGTGCACGGAAAAGACTTCCCCGAGATAACGGGCGATGACAGCGAGGATAACTTCCCGCACTTCACTTCCACCAGCGTCGGT
GGTTTCGACAACAGGGTCGTCACTGACTACCTGAACGGCTCGTCGACGAACCCTCTCGTTGTGGGCAAGAATGAGACAAACAACTCGGACAAACGCATTTTTGGCGCCGACGGCAACGTC
ACTATGCAAGCTCTCGCCGACCCGGCCACCTTCATGGAGCGCTGCTCAGACATCTTTACCCGCATGATCGACACCGTCCCCGCCGCCGTCACGCTCTCCGACGTCATCGATAGTCTCGAC
GTGAAGCCCTACGGCTTGCAGTTGTCACTGAACTCGGATGCCAAAACGCTGCACTTTAGTGGAAAGATCCGCATCAAGACGACGAAGCGCGATGCTAATGACATGAGCGTGTCACTAGCG
TACCGCGATCGCAACGGCAAGTCGTGTAACAACTGCAAGATCGCTACGACCATTGCTGTGCTTCGCGGCGGCCAGAGCTACAACTGGAAAGACACATTTAACTGGTTCGAGTTTGATACG
ACACTCGATGCCGACACATCCATCTCCGGATTCGACGTTCTCATCACCGAAGCCGGAAAGACTGAGACACGGGATAACAACGGCCATGGCTATCCAGTTCAGGACAGTATCCTTTACCAG
TTCGACCAGTCGTGCCTCCCCCAAGAAGCGGACGCGGACGGCAACTGGCCTCTGCAGGTCGTGGCCGCTATCCGCAAAGACAGTGTTTCCGTTCCTGCTGTTCTTGAATTTGCGGCTAAG
GTCCCGAGACAGGGGTCCATTACACCTCGTTTGGAAGTACAGTCGAGCAAGTTCGAGAAGATTGAGGGTGGCGAGAAGGGTCAGTATGTTCTATTCAAAGCGACGCAACCGGTGCTGCCG
GCCTCTTGGAGTTCCAATATGGATTTGGTTCTTGGTAAAGGGGATGCGGAGAAGATGGTTGAGTTTCAGCGCACAAATGAGATAGGACAGGAGTGTAAGGCATTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTTCATCGCTAGCGAGCATTGCTTTGTTGCAATTCCTTCGCGCCAATGCTGACTACACTTGGCCTTCTAAACATGATTTCCTTGAAGATCTCATAAGTATCCAGAGTGGCTAT
ATCCACGAAGGCTTCGGAGATG
CTGTCAACCCTTGCGGCTCATCCCCCGACGGACATGGCCGCCAGTCGGCAGCAGAATGGATACGATCTGCTTACCATGACATGTCCACCCATGATGTC
AACACCGGTCATGGAGGAATGGATGGGTCCATCGTTCTGGAGACAGCGCGCGATGAAAACGTCGGAGACGCATTCAACAGTACCTTCGGTTTCATGGAGATTTGGCATACCTCGCGCTCT
TCCATGGCAGACTTGCTCGCCATCGGCGTCAAGGTTGCATCCGCATCTTGCCAAGGCCCTGAAGTAGCCTTCCGCGCTGGCCGCATCGACGCAACCGACTTGGGAGTTACGGGCGTGCCA
AAACCCGATCAAGATCTCAAGACACACACGACCAAGTTCGCAAACCAGGGCTTCAACGTTAGTGACATGATTGCCATGGTGGCATGCGGCCACGCCTTCGGCGGCGTGCACGGAAAAGAC
TTCCCCGAGATAACGGGCGATGACAGCGAGGATAACTTCCCGCACTTCACTTCCACCAGCGTCGGTGGTTTCGACAACAGGGTCGTCACTGACTACCTGAACGGCTCGTCGACGAACCCT
CTCGTTGTGGGCAAGAATGAGACAAACAACTCGGACAAACGCATTTTTGGCGCCGACGGCAACGTCACTATGCAAGCTCTCGCCGACCCGGCCACCTTCATGGAGCGCTGCTCAGACATC
TTTACCCGCATGATCGACACCGTCCCCGCCGCCGTCACGCTCTCCGACGTCATCGATAGTCTCGACGTGAAGCCCTACGGCTTGCAGTTGTCACTGAACTCGGATGCCAAAACGCTGCAC
TTTAGTGGAAAGATCCGCATCAAGACGACGAAGCGCGATGCTAATGACATGAGCGTGTCACTAGCGTACCGCGATCGCAACGGCAAGTCGTGTAACAACTGCAAGATCGCTACGACCATT
GCTGTGCTTCGCGGCGGCCAGAGCTACAACTGGAAAGACACATTTAACTGGTTCGAGTTTGATACGACACTCGATGCCGACACATCCATCTCCGGATTCGACGTTCTCATCACCGAAGCC
GGAAAGACTGAGACACGGGATAACAACGGCCATGGCTATCCAGTTCAGGACAGTATCCTTTACCAGTTCGACCAGTCGTGCCTCCCCCAAGAAGCGGACGCGGACGGCAACTGGCCTCTG
CAGGTCGTGGCCGCTATCCGCAAAGACAGTGTTTCCGTTCCTGCTGTTCTTGAATTTGCGGCTAAGGTCCCGAGACAGGGGTCCATTACACCTCGTTTGGAAGTACAGTCGAGCAAGTTC
GAGAAGATTGAGGGTGGCGAGAAGGGTCAGTATGTTCTATTCAAAGCGACGCAACCGGTGCTGCCGGCCTCTTGGAGTTCCAATATGGATTTGGTTCTTGGTAAAGGGGATGCGGAGAAG
ATGGTTGAGTTTCAGCGCACAAATGAGATAGGACAGGAGTGTAAGGCATTT

Retrieve as FASTA