Entry information : DcryCcP03
Entry ID 12281
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DcryCcP03
Name DcryCcP03
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Dioszegia
Organism Dioszegia cryoxerica    [TaxId: 603311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DcryCcP03
start..stop
S start..stop
DcryCcP04 777 0 1..376 1..376
TmesCcP01 563 0 1..374 1..373
CnCcP01_JEC21 552 0 1..375 1..377
CnCcP01_grubiiH99 530 0 1..375 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50454..50567 114 N° 2 50713..50965 253 N° 3 51027..51166 140 N° 4 51210..51439 230
N° 5 51493..51610 118 N° 6 51657..51754 98 N° 7 51846..51929 84 N° 8 51976..52069 94
join(50454..50567,50713..50965,51027..51166,51210..51439,51493..51610,51657..517 54,51846..51929,51976..52069)


exon

Literature and cross-references DcryCcP03
DNA ref. JGI genome:   scaffold_86 (50454..52069)
Cluster/Prediction ref. JGI gene:   305041
Protein sequence: DcryCcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377
PWM (Da):   %s   41520.78  
PI (pH):   %s   8.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRLAPVARSVCARRSANLVQARQQVIKRRFADGPQVHPPPPPRASSVPYFLGAVGIAAAGAAYLFFGTDGSAQDTAKEIGTAAKGAVQAVERKTGLAHSQEDYQKVYDAIADALEVEGYDDGSLAPVLVRLAWHCSGTYDDKDKTGGSNYATMRFKPEAEHGANNGNIARDHMQKIKEKFPWISYGDLWTLGGVVAIQESGGPTIPWRAGRIDGFEHHVTPDGRLPDAAQAQDHLRFIFYRMGMDDKEIVALSGAHALGRCHTDRSGFEGPWSFSPTTFSNYFDLLLNEPWQWRKWKGPAQYEDKKTKTLMMLPTDMALIKDKSFRKYAEKYAKDEGEFFKDFSAAFSKLLELGVPKAQFPSTSWTMGSADK

Retrieve as FASTA  
Remarks complete sequence from genomics (7 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTACGCCTCGCTCCCGTGGCCCGCTCCGTCTGCGCTAGGCGCTCGGCCAACCTCGTCCAGGCCCGCCAACAGGTCATCAAGCGGAGGTTCGCTGATGGGCCTCAAGTCGTAAGT
TCGCCGGTCCAGATTGAAATCGAGTCGACGTGTGTGGATCAATCGTGATCTGCGTCCCAGCAAGGAGACGTTGAGCGCATCAAAGTGCTGGGCTTGAAGCTCGGATGTGACACTGCAAAG
GACCGCGCTGACTCATCAGCACCCCCCACCTCCACCCCGCGCGTCCTCGGTCCCCTACTTCCTCGGCGCGGTCGGTATCGCCGCTGCCGGAGCCGCCTACCTCTTCTTCGGCACCGACGG
GTCCGCTCAGGACACGGCCAAGGAGATCGGAACTGCCGCCAAGGGTGCTGTTCAGGCTGTTGAGCGCAAGACGGGTCTGGCCCACAGCCAGGAGGACTACCAGAAGGTGTACGATGCTAT
TGCGGATGCGCTAGAGGTTGAGGGCTACGATG
GTGAGTCAGCTGGAGAGATCGGAGTATGGATGGCCCGAGGAATAGAAGCTGACCATCCCAGATGGCTCCCTCGCCCCCGTCCTCGTCC
GTCTCGCGTGGCACTGCTCCGGCACGTACGACGACAAGGACAAGACCGGCGGATCCAACTACGCAACCATGCGATTCAAGCCTGAAGCCGAGCACGGTGCCAACAACGGTCTG
GTGCGTC
TATCCGCTCGTGTCATCGCTCCCAGCTGATCCCCAGAACATCGCCCGGGACCACATGCAGAAGATCAAGGAGAAGTTCCCGTGGATCTCGTACGGTGATCTCTGGACGCTCGGGGGTGTT
GTCGCCATCCAGGAGTCGGGCGGACCTACCATCCCCTGGAGGGCTGGCCGGATTGACGGGTTCGAGCACCACGTAACTCCTGATGGTCGGCTGCCCGATGCCGCCCAGGCTCAGGACCAC
TTGCGGTTCATCTTCTACCGGATGGG
GTGAGTTTCCCTGAGCAGAAAGCTGTGAGATAGCGGACACTGATGACAATTAGTATGGATGACAAGGAGATCGTCGCTCTGTCGGGCGCACACG
CTCTTGGCCGATGCCACACTGACCGCTCGGGCTTCGAAGGGCCTTGGTCCTTCTCTCCTACGACCTTCTCCAACGCT
GTAAGTACACTGCTAAGGCTCGTTGGCAGCCCACTGACGACAA
AAGTACTTTGATCTATTGTTGAACGAGCCCTGGCAATGGCGCAAGTGGAAGGGACCTGCGCAGTACGAGGACAAGAAGACCAAGACGTTGATGATGCTCCCGTGAGTTTTTGCGTTTTTT
CCGTCGGATTTTGGTCGGAAACGCACTTTCTGGCCCTTTTCAGCCCATGGATTACCTGTGCTGACGACGCAGCACCGACATGGCCCTGATCAAGGACAAGAGCTTCCGAAAGTACGCCGA
AAAGTACGCCAAGGACGAGGGGGAGTTCTTCAAGGA
GTGAGTTTCGGGGTTGCGATGGTATGAGCGATGAGCTGACGTACAGCTTCTCTGCGGCGTTCTCTAAGCTGCTTGAGCTGGGTG
TGCCCAAGGCGCAGTTCCCATCGACCAGCTGGACCATGGGATCTGCGGACAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTACGCCTCGCTCCCGTGGCCCGCTCCGTCTGCGCTAGGCGCTCGGCCAACCTCGTCCAGGCCCGCCAACAGGTCATCAAGCGGAGGTTCGCTGATGGGCCTCAAGTCCACCCC
CCACCTCCACCCCGCGCGTCCTCGGTCCCCTACTTCCTCGGCGCGGTCGGTATCGCCGCTGCCGGAGCCGCCTACCTCTTCTTCGGCACCGACGGGTCCGCTCAGGACACGGCCAAGGAG
ATCGGAACTGCCGCCAAGGGTGCTGTTCAGGCTGTTGAGCGCAAGACGGGTCTGGCCCACAGCCAGGAGGACTACCAGAAGGTGTACGATGCTATTGCGGATGCGCTAGAGGTTGAGGGC
TACGATG
ATGGCTCCCTCGCCCCCGTCCTCGTCCGTCTCGCGTGGCACTGCTCCGGCACGTACGACGACAAGGACAAGACCGGCGGATCCAACTACGCAACCATGCGATTCAAGCCTGAA
GCCGAGCACGGTGCCAACAACGGTCTG
AACATCGCCCGGGACCACATGCAGAAGATCAAGGAGAAGTTCCCGTGGATCTCGTACGGTGATCTCTGGACGCTCGGGGGTGTTGTCGCCATC
CAGGAGTCGGGCGGACCTACCATCCCCTGGAGGGCTGGCCGGATTGACGGGTTCGAGCACCACGTAACTCCTGATGGTCGGCTGCCCGATGCCGCCCAGGCTCAGGACCACTTGCGGTTC
ATCTTCTACCGGATGGG
TATGGATGACAAGGAGATCGTCGCTCTGTCGGGCGCACACGCTCTTGGCCGATGCCACACTGACCGCTCGGGCTTCGAAGGGCCTTGGTCCTTCTCTCCTACG
ACCTTCTCCAACGCT
TACTTTGATCTATTGTTGAACGAGCCCTGGCAATGGCGCAAGTGGAAGGGACCTGCGCAGTACGAGGACAAGAAGACCAAGACGTTGATGATGCTCCCCACCGAC
ATGGCCCTGATCAAGGACAAGAGCTTCCGAAAGTACGCCGAAAAGTACGCCAAGGACGAGGGGGAGTTCTTCAAGGA
CTTCTCTGCGGCGTTCTCTAAGCTGCTTGAGCTGGGTGTGCCC
AAGGCGCAGTTCCCATCGACCAGCTGGACCATGGGATCTGCGGACAAGTAG

Retrieve as FASTA