Entry information : DcryCcP04
Entry ID 12282
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DcryCcP04
Name DcryCcP04
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Dioszegia
Organism Dioszegia cryoxerica    [TaxId: 603311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DcryCcP04
start..stop
S start..stop
DcryCcP03 777 0 1..376 1..376
TmesCcP01 563 0 1..374 1..373
CnCcP01_JEC21 551 0 1..375 1..377
CnCcP01_grubiiH99 529 0 1..375 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10413..10526 114 N° 2 10011..10263 253 N° 3 9812..9951 140 N° 4 9540..9769 230
N° 5 9268..9483 216 N° 6 9100..9183 84 N° 7 8956..9049 94  
complement(join(8956..9049,9100..9183,9268..9483,9540..9769,9812..9951,10011..10 263,10413..10526))


exon

Literature and cross-references DcryCcP04
DNA ref. JGI genome:   scaffold_77 (10526..8956)
Cluster/Prediction ref. JGI gene:   418009
Protein sequence: DcryCcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377
PWM (Da):   %s   41488.79  
PI (pH):   %s   8.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRLAPVARSVCARRSANLVQARQQVIKRRFADGPQVHPPPPPRASSVPYFLGAVGIAAAGAAYLFFGTDGSAQDTAKEIGTAAKGAVQAVERKTGLAHSQEDYQKVYDAIADALEVEGYDDGSLAPVLVRLAWHCSGTYDDKDKTGGSNYATMRFKPEAEHGANNGNIARDHMQKIKEKFPWISYGDLWTLGGVVAIQESGGPTIPWRAGRIDGFEHHVTPDGRLPDAAQAQDHLRFIFYRMGMDDKEIVALSGAHALGRCHTDRSGFEGPWSFSPTTFSNAYFDLLLNEPWQWRKWKGPAQYEDKKTKTLMMLPTDMALIKDKSFRKYAEKYAKDEGEFFKDFSAAFAKLLELGVPKAQFPATSWTMGSADK

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTACGCCTCGCTCCCGTTGCTCGCTCTGTCTGCGCTAGGCGCTCGGCCAACCTCGTCCAGGCCCGCCAACAGGTCATCAAGCGGAGGTTCGCTGATGGGCCTCAAGTCGTAAGT
CCCGCCGGTCCAGATTGAAATCGAGTCGACGTGTATGGAAGACCGTGGTGACTCGCGCGTGAGCGACAGACTGTCGAGTATAGAGATGCTCTGGATCTGCAGCAGGAAGCATACCGTATC
AAGGGTCCGCGCTGACTCATCAGCACCCCCCACCTCCACCCCGCGCGTCCTCGGTCCCCTACTTCCTCGGTGCGGTCGGTATCGCCGCCGCCGGAGCCGCCTACCTCTTCTTCGGCACCG
ACGGGTCCGCTCAGGACACGGCCAAGGAGATTGGAACTGCAGCTAAGGGCGCTGTCCAGGCTGTTGAGCGCAAGACGGGTCTGGCCCACAGCCAGGAGGACTACCAGAAGGTGTACGATG
CTATTGCGGATGCGCTCGAGGTCGAGGGCTACGATG
GTGAGTCTGCTGAGGTGCCTGGAGTGTAGCTCCCCGACGAACGGTAGCTGACATCCCAGATGGTTCCCTCGCCCCCGTGCTCGT
CCGTCTCGCGTGGCACTGCTCCGGCACGTACGACGACAAAGACAAGACCGGTGGATCCAACTACGCGACTATGCGATTCAAGCCTGAGGCCGAGCACGGTGCCAACAACGGTCTG
GTGCG
TCTCTTCCCTCCTGGCATACTCTCAGCTGACATTTAGAACATCGCCCGGGACCACATGCAGAAGATCAAGGAGAAGTTCCCGTGGATCTCGTACGGTGATCTCTGGACCCTTGGGGGTGT
TGTCGCCATCCAGGAGTCGGGCGGACCTACCATCCCCTGGAGGGCTGGCCGGATTGACGGGTTCGAGCACCACGTCACTCCTGACGGACGGCTGCCCGATGCCGCTCAGGCTCAGGACCA
CTTGAGGTTCATCTTCTACCGTATGGG
GTGAGTCGCCATGCGCCTGAATGCCACAAGTACGAGTGTATGGCTGACTATCATAGAATGGATGACAAGGAGATCGTCGCTCTCTCTGGCGCC
CATGCTCTCGGCCGATGCCACACCGACCGATCTGGCTTTGAGGGTCCATGGTCTTTCTCACCTACCACGTTCTCAAACGCATACTTTGATCTATTGTTGAATGAGCCCTGGCAATGGCGC
AAGTGGAAGGGACCTGCGCAGTACGAGGACAAGAAGACCAAGACGTTGATGATGCTCCC
GTGAGTCTTTTGGCCCTTTTTCTTTTGATTTTTGGCCGGAAACGCACCTTCTGGCCCTTTC
TCGGCCTTGTGCTAACGACGCAGCACCGACATGGCTCTGATCAAGGATAAGAGCTTCCGAAAGTACGCCGAGAAGTACGCCAAGGACGAGGGGGAGTTCTTCAAGGAGTGAGTTTGGCGA
AAATTGCATAATTGTAGGGGTGTGCTAATTTTTCTAGCTTCTCTGCGGCTTTCGCTAAGCTGCTTGAGCTAGGTGTCCCCAAGGCTCAGTTCCCAGCGACCAGCTGGACCATGGGATCTG
CGGACAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTACGCCTCGCTCCCGTTGCTCGCTCTGTCTGCGCTAGGCGCTCGGCCAACCTCGTCCAGGCCCGCCAACAGGTCATCAAGCGGAGGTTCGCTGATGGGCCTCAAGTCCACCCC
CCACCTCCACCCCGCGCGTCCTCGGTCCCCTACTTCCTCGGTGCGGTCGGTATCGCCGCCGCCGGAGCCGCCTACCTCTTCTTCGGCACCGACGGGTCCGCTCAGGACACGGCCAAGGAG
ATTGGAACTGCAGCTAAGGGCGCTGTCCAGGCTGTTGAGCGCAAGACGGGTCTGGCCCACAGCCAGGAGGACTACCAGAAGGTGTACGATGCTATTGCGGATGCGCTCGAGGTCGAGGGC
TACGATG
ATGGTTCCCTCGCCCCCGTGCTCGTCCGTCTCGCGTGGCACTGCTCCGGCACGTACGACGACAAAGACAAGACCGGTGGATCCAACTACGCGACTATGCGATTCAAGCCTGAG
GCCGAGCACGGTGCCAACAACGGTCTG
AACATCGCCCGGGACCACATGCAGAAGATCAAGGAGAAGTTCCCGTGGATCTCGTACGGTGATCTCTGGACCCTTGGGGGTGTTGTCGCCATC
CAGGAGTCGGGCGGACCTACCATCCCCTGGAGGGCTGGCCGGATTGACGGGTTCGAGCACCACGTCACTCCTGACGGACGGCTGCCCGATGCCGCTCAGGCTCAGGACCACTTGAGGTTC
ATCTTCTACCGTATGGG
AATGGATGACAAGGAGATCGTCGCTCTCTCTGGCGCCCATGCTCTCGGCCGATGCCACACCGACCGATCTGGCTTTGAGGGTCCATGGTCTTTCTCACCTACC
ACGTTCTCAAACGCATACTTTGATCTATTGTTGAATGAGCCCTGGCAATGGCGCAAGTGGAAGGGACCTGCGCAGTACGAGGACAAGAAGACCAAGACGTTGATGATGCTCCC
CACCGAC
ATGGCTCTGATCAAGGATAAGAGCTTCCGAAAGTACGCCGAGAAGTACGCCAAGGACGAGGGGGAGTTCTTCAAGGA
CTTCTCTGCGGCTTTCGCTAAGCTGCTTGAGCTAGGTGTCCCC
AAGGCTCAGTTCCCAGCGACCAGCTGGACCATGGGATCTGCGGACAAGTAG

Retrieve as FASTA