Entry information : ParcCIIBB02
Entry ID 12288
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2018-01-18 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-01-18 (Catherine Mathe)
Peroxidase information: ParcCIIBB02
Name ParcCIIBB02
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Polyporus
Organism Polyporus arcularius    [TaxId: 5639 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ParcCIIBB02
start..stop
S start..stop
ParcCIIBB08 685 0 1..361 1..361
ParcCIIBB11 625 0 1..364 1..364
DsCIIBB08 624 0 1..364 1..366
TvCIIBB06 606 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1051..1111 61 N° 2 1170..1374 205 N° 3 1434..1568 135 N° 4 1623..1823 201
N° 5 1877..2118 242 N° 6 2189..2426 238 N° 7 2479..2491 13  
join(1051..1111,1170..1374,1434..1568,1623..1823,1877..2118,2189..2426,2479..249 1)


exon

Literature and cross-references ParcCIIBB02
DNA ref. JGI genome:   scaffold_216 (1051..2491)
Cluster/Prediction ref. JGI gene:   549633
Protein sequence: ParcCIIBB02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   38077.74 (35865.6)  
PI (pH):   %s   4.17 (4.13) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLASFVSVLAAFQAANGALVRRVTCADGSVTANAACCALFPVIQDLQTNLFDGGECGEEVHESLRLTFHDAIGISPAIASRGQFGGGGADGSIAIFDDIETNFHANNGVDEIIGEQRPLIQRHNITTADFIQLAGAIGVSNCPGAPRLAVFVGRPDATQPAPDLTVPEPFDTVDSILQRFDDAGGFTPEEVVALLGSHTIAAADHVDPSIPGTPFDSTPELFDTQFFIETQLRGTLFPGTGGNQGEVESPLRGELRLQSDSELARDSRTACEWQSFNNQAKLQSAFAAAFRKMTILGHDEGSLVDCSDVVPTPPAPASQAHLPAGLTHNDVEQACASTPFPTLPTDPGPATSVAPVPPS

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACACTCGCGTCTTTCGTCTCAGTTCTCGCGGCTTTCCAAGCCGCTAACGGTCAGTCGACCCCCAAGCTTCTTGGCGGCAGCTTCTTACTCCCACTTCTTTGGCTTAGG
TGCCCTCGTCCGCCGAGTTACTTGCGCTGACGGCAGCGTCACGGCGAACGCGGCGTGCTGCGCACTCTTCCCGGTTATTCAGGATCTCCAGACGAACCTCTTCGACGGCGGCGAGTGCGG
TGAGGAGGTCCACGAATCCCTCCGTCTGACCTTCCACGACGCCATCGGTATATCCCCCGCCATCGCCTCCCGCGGCCAATTCGG
GTCAGTACGAATGCTGCCTGCTAACTATGCATGCAT
GTCTGAGACTTGACTTTTGACAGTGGTGGCGGCGCCGACGGTTCGATCGCCATATTCGACGACATCGAGACTAACTTCCACGCGAACAACGGTGTCGATGAGATCATCGGCGAACAACGC
CCGCTCATCCAGCGCCACAACATCACCACGGCTGACTT
GTAAGCCCACTGCATACTACAGTCTGCAATGCACACGACTGATCCTCCCCTTAGCATCCAGCTCGCTGGTGCCATCGGTGTC
AGCAACTGTCCTGGTGCTCCTCGCCTCGCGGTGTTTGTCGGCCGTCCTGATGCCACCCAGCCCGCGCCCGACTTGACCGTCCCGGAGCCCTTTGACACCGTCGACAGCATCCTGCAGCGC
TTCGACGATGCCGGTGGCTTCACCCCTGAAGAGGTTGTGGCTCTCCTTGGCTC
GTAAGTAAATTGACAAACAGCTCCATCTATCTTTGCTGACAAGTCACCTGTAGCCACACTATCGCCG
CGGCCGACCACGTCGACCCCTCGATCCCCGGAACCCCCTTCGACTCGACGCCTGAGCTCTTCGACACTCAGTTCTTCATCGAGACGCAGCTCCGTGGTACGCTCTTCCCCGGCACTGGCG
GCAACCAGGGTGAGGTCGAGTCGCCCCTCCGCGGCGAGCTCCGTCTCCAGTCCGACTCTGAGCTCGCTCGTGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTCGTCA
GTGAGTATCCAA
CAGCCCTCCACTCTCCCCTTCTATGTGGACAGTGAACTCACTTGACGGCCGCATACAGACAACCAGGCCAAGCTCCAGTCCGCCTTCGCTGCTGCCTTCCGCAAGATGACGATCCTCGGC
CACGACGAGGGCTCGCTGGTTGACTGCTCCGACGTCGTCCCGACTCCCCCAGCCCCGGCCTCCCAGGCGCACCTCCCCGCCGGTCTCACTCACAATGACGTCGAGCAGGCTTGTGCCAGC
ACTCCCTTCCCCACTCTCCCCACCGACCCCGGTCCGGCCACCTCCGTTGCCCCTGT
GTAAGTCCTCGTGCAAACGAAGTTGCGGCCTAATACTGACTTGATTGCACAGTCCTCCCTCTTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACACTCGCGTCTTTCGTCTCAGTTCTCGCGGCTTTCCAAGCCGCTAACGGTGCCCTCGTCCGCCGAGTTACTTGCGCTGACGGCAGCGTCACGGCGAACGCGGCGTGC
TGCGCACTCTTCCCGGTTATTCAGGATCTCCAGACGAACCTCTTCGACGGCGGCGAGTGCGGTGAGGAGGTCCACGAATCCCTCCGTCTGACCTTCCACGACGCCATCGGTATATCCCCC
GCCATCGCCTCCCGCGGCCAATTCGG
TGGTGGCGGCGCCGACGGTTCGATCGCCATATTCGACGACATCGAGACTAACTTCCACGCGAACAACGGTGTCGATGAGATCATCGGCGAACAA
CGCCCGCTCATCCAGCGCCACAACATCACCACGGCTGACTT
CATCCAGCTCGCTGGTGCCATCGGTGTCAGCAACTGTCCTGGTGCTCCTCGCCTCGCGGTGTTTGTCGGCCGTCCTGAT
GCCACCCAGCCCGCGCCCGACTTGACCGTCCCGGAGCCCTTTGACACCGTCGACAGCATCCTGCAGCGCTTCGACGATGCCGGTGGCTTCACCCCTGAAGAGGTTGTGGCTCTCCTTGGC
TC
CCACACTATCGCCGCGGCCGACCACGTCGACCCCTCGATCCCCGGAACCCCCTTCGACTCGACGCCTGAGCTCTTCGACACTCAGTTCTTCATCGAGACGCAGCTCCGTGGTACGCTC
TTCCCCGGCACTGGCGGCAACCAGGGTGAGGTCGAGTCGCCCCTCCGCGGCGAGCTCCGTCTCCAGTCCGACTCTGAGCTCGCTCGTGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTC
GTCA
ACAACCAGGCCAAGCTCCAGTCCGCCTTCGCTGCTGCCTTCCGCAAGATGACGATCCTCGGCCACGACGAGGGCTCGCTGGTTGACTGCTCCGACGTCGTCCCGACTCCCCCAGCC
CCGGCCTCCCAGGCGCACCTCCCCGCCGGTCTCACTCACAATGACGTCGAGCAGGCTTGTGCCAGCACTCCCTTCCCCACTCTCCCCACCGACCCCGGTCCGGCCACCTCCGTTGCCCCT
GT
TCCTCCCTCTTAA

Retrieve as FASTA