Entry information : ParcCIIBB11
Entry ID 12296
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2017-03-02 (Catherine Mathe)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-03-02 (Catherine Mathe)
Peroxidase information: ParcCIIBB11
Name ParcCIIBB11
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Polyporus
Organism Polyporus arcularius    [TaxId: 5639 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ParcCIIBB11
start..stop
S start..stop
ParcCIIBB08 629 0 1..361 1..361
ParcCIIBB02 624 0 1..364 1..364
TvCIIBB02 587 0 1..364 1..365
TvCIIBB02_IFO30340 587 0 1..364 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3494..3554 61 N° 2 3221..3425 205 N° 3 3026..3160 135 N° 4 2770..2970 201
N° 5 2480..2721 242 N° 6 2172..2409 238 N° 7 2100..2112 13  
complement(join(2100..2112,2172..2409,2480..2721,2770..2970,3026..3160,3221..342 5,3494..3554))


exon

Literature and cross-references ParcCIIBB11
DNA ref. JGI genome:   scaffold_604 (3554..2100)
Cluster/Prediction ref. JGI gene:   327880
Protein sequence: ParcCIIBB11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   37995.74 (35832.6)  
PI (pH):   %s   4.01 (4.01) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFAILASFVSALAALQVANGALTRRVTCADGSVTSNAACCALFPVIQDLQANLFDNGGCGEDVHESLRLTFHDAIGISPAIAARGQFGGGGADGSIALFEDIETNFHANLGVDEIIDEQRPLLQRSNISAADFIQLAGAIGVANCPGAPRLAVFVGRQDATQPAPDLTVPEPFDTVDSILQRFEDAGGFTPAEVVALLASHTIAAADHVDPSIPGTPFDSTPELFDTQFFIETQLRGTLFPGTPGNQGEVESPVPGEIRLQSDSELARDSRTACEWQSFNNQAKLQSAFAAAFRKMTILGHDESELVDCSDVVQQPPPPASAAHFPAGLSNADIEQACASTPFPTLPTDPGPVTSVAPVPPS

Retrieve as FASTA  
Remarks incorrect prediction from genomics (6 introns). 5'end too long
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTCGCAATCCTCGCCTCCTTCGTCTCTGCCCTCGCGGCTCTTCAGGTCGCCAACGGTCAGTCCCTTGCCAAGTCTCTTAGCTGCCCGCAGACTCTCATATACATATACATTTCC
CTTGCATAGGTGCCCTTACTCGCCGGGTTACCTGCGCCGACGGCAGCGTGACATCCAACGCGGCATGCTGCGCGCTCTTCCCGGTCATTCAAGACCTCCAGGCTAACCTCTTCGACAACG
GTGGATGTGGCGAGGACGTCCACGAGTCCCTTCGCTTGACCTTCCACGATGCCATTGGTATCTCCCCTGCCATCGCCGCTCGCGGGCAATTCGG
GTCAGTGCTTGCTTTTTGCAGTGCCG
CCTTCGTCTGCCCATTATTGACACACTCCTTCAGTGGTGGAGGCGCCGACGGCTCGATCGCCCTGTTCGAGGACATCGAGACCAACTTCCACGCGAACCTTGGTGTCGATGAGATCATCG
ACGAGCAGCGTCCCCTCCTCCAGCGCTCCAACATCAGCGCGGCTGACTT
GTAAGTCATCTTATCTCACAGGCGGAATACATGACTGAGCTCACTTCTTATCCAGCATTCAGCTTGCTGGT
GCGATCGGTGTCGCCAACTGCCCCGGTGCTCCTCGCCTCGCCGTCTTTGTCGGCCGCCAGGATGCTACTCAGCCCGCACCCGACTTGACAGTCCCTGAGCCTTTCGACACCGTCGACAGC
ATCCTGCAGCGCTTCGAGGATGCCGGCGGCTTCACCCCCGCTGAAGTTGTCGCCCTCCTCGCCTC
GTAAGCATCGCATTTCCGACATTGCGATAGTACTTACGATCTATACAGTCACACG
ATCGCTGCAGCCGACCACGTGGACCCGAGCATCCCCGGAACGCCTTTCGACTCTACGCCTGAGTTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACCCTCTTCCCCGGA
ACCCCAGGTAACCAGGGCGAGGTCGAGTCACCGGTCCCCGGCGAGATCCGTCTCCAGTCTGACTCTGAGCTCGCTCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTTGTCA
GTGAG
TATCCGACAATCAGTCCGAAACATCTCATCCGTCTCCACTGTACTCAACCCGCAACCGCACACAGACAACCAGGCTAAGCTCCAGTCCGCGTTCGCCGCTGCGTTCCGCAAGATGACGAT
CCTCGGCCACGACGAGAGCGAGCTCGTCGACTGCTCCGACGTCGTTCAGCAGCCCCCGCCTCCGGCTTCCGCTGCGCACTTCCCCGCCGGCCTTAGCAACGCCGACATCGAGCAGGCGTG
CGCCAGCACTCCCTTCCCCACTCTCCCCACCGACCCCGGCCCGGTCACGTCGGTCGCACCTGT
GTAAGTGTCCCTTTGAGACATGAGTTCATCTGAACGACGCTGATATCCCGCCTGTGC
AGCCCTCCTTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTCGCAATCCTCGCCTCCTTCGTCTCTGCCCTCGCGGCTCTTCAGGTCGCCAACGGTGCCCTTACTCGCCGGGTTACCTGCGCCGACGGCAGCGTGACATCCAACGCGGCATGC
TGCGCGCTCTTCCCGGTCATTCAAGACCTCCAGGCTAACCTCTTCGACAACGGTGGATGTGGCGAGGACGTCCACGAGTCCCTTCGCTTGACCTTCCACGATGCCATTGGTATCTCCCCT
GCCATCGCCGCTCGCGGGCAATTCGG
TGGTGGAGGCGCCGACGGCTCGATCGCCCTGTTCGAGGACATCGAGACCAACTTCCACGCGAACCTTGGTGTCGATGAGATCATCGACGAGCAG
CGTCCCCTCCTCCAGCGCTCCAACATCAGCGCGGCTGACTT
CATTCAGCTTGCTGGTGCGATCGGTGTCGCCAACTGCCCCGGTGCTCCTCGCCTCGCCGTCTTTGTCGGCCGCCAGGAT
GCTACTCAGCCCGCACCCGACTTGACAGTCCCTGAGCCTTTCGACACCGTCGACAGCATCCTGCAGCGCTTCGAGGATGCCGGCGGCTTCACCCCCGCTGAAGTTGTCGCCCTCCTCGCC
TC
TCACACGATCGCTGCAGCCGACCACGTGGACCCGAGCATCCCCGGAACGCCTTTCGACTCTACGCCTGAGTTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACCCTC
TTCCCCGGAACCCCAGGTAACCAGGGCGAGGTCGAGTCACCGGTCCCCGGCGAGATCCGTCTCCAGTCTGACTCTGAGCTCGCTCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTT
GTCA
ACAACCAGGCTAAGCTCCAGTCCGCGTTCGCCGCTGCGTTCCGCAAGATGACGATCCTCGGCCACGACGAGAGCGAGCTCGTCGACTGCTCCGACGTCGTTCAGCAGCCCCCGCCT
CCGGCTTCCGCTGCGCACTTCCCCGCCGGCCTTAGCAACGCCGACATCGAGCAGGCGTGCGCCAGCACTCCCTTCCCCACTCTCCCCACCGACCCCGGCCCGGTCACGTCGGTCGCACCT
GT
CCCTCCTTCCTAA

Retrieve as FASTA