Entry information : ParcCIIBB08
Entry ID 12298
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2018-01-18 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-01-18 (Catherine Mathe)
Peroxidase information: ParcCIIBB08
Name ParcCIIBB08
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Polyporus
Organism Polyporus arcularius    [TaxId: 5639 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ParcCIIBB08
start..stop
S start..stop
ParcCIIBB02 685 0 1..361 1..361
ParcCIIBB11 630 0 1..361 1..361
DsCIIBB08 619 0 1..361 1..363
TvCIIBB02 605 0 1..361 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17841..17901 61 N° 2 17964..18168 205 N° 3 18218..18352 135 N° 4 18419..18619 201
N° 5 18672..18913 242 N° 6 18975..19216 242  
join(17841..17901,17964..18168,18218..18352,18419..18619,18672..18913,18975..192 16)


exon

Literature and cross-references ParcCIIBB08
DNA ref. JGI genome:   scaffold_543 (17841..19216)
Cluster/Prediction ref. JGI gene:   500632
Protein sequence: ParcCIIBB08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (340)
PWM (Da):   %s   37793.65 (35575.4)  
PI (pH):   %s   4.17 (4.13) Peptide Signal:   %s   cut: 22 range:22-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLASFVSVLAALQVANGALVRRVTCADGSVTSNAACCALFPVIQDLQTNLFDGGECGEEVHESLRLTFHDAIGISPAIASRGQFGGGGADGSIALFEDIETNFHANNGVDEIIDEQRPLIQRHNLTTADFIQLAGAIGVSNCPGAPRLAVFVGRPDATQPAPDLTVPEPFDTVDSILQRFDDAGGFTPAEVVALLGSHTIAAADHVDPSIPGTPFDSTPELFDTQFFIETQLRGTLFPGTGGNQGEVESPLRGELRLQSDSELARDSRTACEWQSFNNQAKLQSAFAAAFRKMTILGHDEGSLVDCSDVVPTPPAPASSAHLPAGLTHNDVEQACASTPFPTLPTDPGPATTVAPV

Retrieve as FASTA  
Remarks complete sequence from genomics (5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACACTCGCGTCTTTCGTCTCGGTTCTTGCGGCCCTCCAGGTCGCCAACGGTCAGCCTCCCTCCCCGAGCTTCCTTGTTAATAAAGCTCACTCTCCCGCTTTCATGGCA
TAGGTGCCCTCGTACGCCGGGTCACTTGCGCTGACGGCAGCGTCACGTCCAACGCGGCGTGTTGCGCGCTCTTCCCGGTGATCCAGGATCTCCAGACGAACCTCTTCGACGGCGGCGAGT
GCGGTGAGGAGGTCCACGAATCCCTTCGTCTGACCTTCCACGACGCCATCGGTATCTCCCCCGCCATCGCCTCCCGCGGCCAATTCGG
GTCAGTTCCATACTGCCTGATCACTCGTACAT
CTCTGACAATCCTACAGTGGCGGAGGTGCGGACGGTTCGATCGCCCTGTTCGAAGACATCGAGACCAACTTCCACGCGAACAACGGTGTCGACGAGATCATCGACGAACAGCGCCCCCTC
ATCCAACGTCACAACCTCACCACGGCTGACTT
GTAAGCTCCCCAAGTACCGAGTATCGTCGACAAAGCACACGACTCATCCTCTTCATTCCACTACAGCATCCAGCTCGCTGGTGCCATC
GGTGTCAGCAACTGCCCTGGTGCCCCTCGTCTCGCCGTCTTCGTTGGTCGCCCCGACGCCACACAGCCCGCGCCCGACCTGACCGTCCCGGAGCCCTTCGACACCGTCGACAGCATTCTG
CAGCGCTTCGATGATGCCGGTGGCTTCACTCCAGCGGAGGTCGTGGCTCTCCTCGGCTC
GTAAGTACATCAGTTTAGGCTATAACATCCTCTTGCTGACGCCGCGTTGCAGCCACACCAT
CGCCGCGGCCGACCACGTCGACCCATCCATCCCGGGAACTCCCTTCGACTCGACTCCTGAGCTTTTCGATACCCAGTTCTTCATCGAGACTCAGCTCCGTGGCACGCTCTTCCCTGGCAC
CGGTGGCAACCAGGGTGAGGTCGAGTCGCCCCTCCGCGGCGAGCTCCGTCTTCAGTCCGACTCCGAGCTCGCTCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTCGTCA
GTGAGTA
TCCAATGCCTGGGCCAATTCCCATCCTCTGCTCACCGGGCGATCGCCCCTACAGACAACCAGGCTAAGCTCCAGTCCGCGTTCGCTGCTGCCTTCCGCAAGATGACGATCCTCGGGCACG
ACGAGGGCTCGCTGGTGGACTGCTCCGACGTCGTCCCGACTCCCCCGGCCCCGGCCTCCAGCGCGCACCTTCCCGCCGGCCTCACCCACAACGACGTCGAGCAGGCTTGCGCCAGCACCC
CCTTCCCCACGCTCCCCACCGACCCCGGTCCGGCCACCACTGTCGCTCCTGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACACTCGCGTCTTTCGTCTCGGTTCTTGCGGCCCTCCAGGTCGCCAACGGTGCCCTCGTACGCCGGGTCACTTGCGCTGACGGCAGCGTCACGTCCAACGCGGCGTGT
TGCGCGCTCTTCCCGGTGATCCAGGATCTCCAGACGAACCTCTTCGACGGCGGCGAGTGCGGTGAGGAGGTCCACGAATCCCTTCGTCTGACCTTCCACGACGCCATCGGTATCTCCCCC
GCCATCGCCTCCCGCGGCCAATTCGG
TGGCGGAGGTGCGGACGGTTCGATCGCCCTGTTCGAAGACATCGAGACCAACTTCCACGCGAACAACGGTGTCGACGAGATCATCGACGAACAG
CGCCCCCTCATCCAACGTCACAACCTCACCACGGCTGACTT
CATCCAGCTCGCTGGTGCCATCGGTGTCAGCAACTGCCCTGGTGCCCCTCGTCTCGCCGTCTTCGTTGGTCGCCCCGAC
GCCACACAGCCCGCGCCCGACCTGACCGTCCCGGAGCCCTTCGACACCGTCGACAGCATTCTGCAGCGCTTCGATGATGCCGGTGGCTTCACTCCAGCGGAGGTCGTGGCTCTCCTCGGC
TC
CCACACCATCGCCGCGGCCGACCACGTCGACCCATCCATCCCGGGAACTCCCTTCGACTCGACTCCTGAGCTTTTCGATACCCAGTTCTTCATCGAGACTCAGCTCCGTGGCACGCTC
TTCCCTGGCACCGGTGGCAACCAGGGTGAGGTCGAGTCGCCCCTCCGCGGCGAGCTCCGTCTTCAGTCCGACTCCGAGCTCGCTCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTC
GTCA
ACAACCAGGCTAAGCTCCAGTCCGCGTTCGCTGCTGCCTTCCGCAAGATGACGATCCTCGGGCACGACGAGGGCTCGCTGGTGGACTGCTCCGACGTCGTCCCGACTCCCCCGGCC
CCGGCCTCCAGCGCGCACCTTCCCGCCGGCCTCACCCACAACGACGTCGAGCAGGCTTGCGCCAGCACCCCCTTCCCCACGCTCCCCACCGACCCCGGTCCGGCCACCACTGTCGCTCCT
GTGTAA

Retrieve as FASTA