Entry information : AtPrx30 (At3g21770 / PER30 / PER30 / PRXR9 / ATP7a / Atprxr9ge)
Entry ID 123
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx30 (At3g21770 / PER30 / PER30 / PRXR9 / ATP7a / Atprxr9ge)
Name (synonym) AtPrx30 (At3g21770 / PER30 / PER30 / PRXR9 / ATP7a / Atprxr9ge)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Mixed tissues
Roots
Rosettes
Stamen Abscission Zone
Inducers Dark growth
Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx30
start..stop
S start..stop
AlyPrx30 649 0 1..329 1..329
CagraPrx41 622 0 4..329 1..326
BstrPrx02 621 0 1..329 1..329
CrubPrx66 618 0 4..329 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7673345..7673566 222 N° 2 7673733..7673921 189 N° 3 7674004..7674166 163 N° 4 7674246..7674661 416
join(7673345..7673566,7673733..7673921,7674004..7674166,7674246..7674661)


exon

Literature and cross-references AtPrx30 (At3g21770 / PER30 / PER30 / PRXR9 / ATP7a / Atprxr9ge)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
Protein ref. UniProtKB:   Q9LSY7
DNA ref. Phytozome 11:   Chr3 (7673345..7674661)
mRNA ref. GenBank:   NM_113072
Cluster/Prediction ref. Phytozome Gene 11:   19660274 UniGene:   At.25181
Omic ref. AtProteome:   At3g21770 ATTED-II:   At3g21770 e-FP Browser:   At3g21770 ePlant:   At3g21770 Genevestigator:   At3g21770 TAIR:   At3g21770
Protein sequence: AtPrx30 (At3g21770 / PER30 / PER30 / PRXR9 / ATP7a / Atprxr9ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35678.41 (32793.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   10.27 (10.21) Peptide Signal:   %s   cut: 28 range:28-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTMTQLNIAVVVVVTVLIGMLRSSEAQLQMNFYAKSCPNAEKIISDHIQNHIHNGPSLAAPLIRMHFHDCFVRGCDGSVLINSTSGNAERDAPPNLTLRGFGFVERIKALLEKVCPKTVSCADIIALTARDAVVATGGPSWSVPTGRRDGRISNKTEATNNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSQYAANLKANKCKSLNDNSTILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAKSMEKMGRVKVKTGSAGVIRTRCSVAGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns), 7 cDNA and 29 EST. mainly in roots. Also found from proteomic (Feiz, 2004).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGTGGAAA AGAATTTGTT AGTGGGTTTA GGTGATTATG CGTCGGTATC TTTCCTTTTC ATTGGTCCTT TTTTTATCTT TTATTTTTTT TTTGTCTTTT GCCAAATCTA TTGTTCATTA  AATCAAAGTG AAAAAGTGTC TTTGGAGATT AAACTATTAC ACGATGCTGG AAATGTTCTG ATCCGATCGT TTTTCTTCTT GACGCGTTTT CTTCTTACAG CTGCCTAGCA GCATTGATCT  TCCGAGCAAG AAAAATAGTG GTTAATACCG CATTATTTAA TCAAGTTACT ATTATCCGAT TTGAAAAATG AAATTTCCTA GTTTTATATT ATTAACTCTA AAGTCTTGGA ATGAAATTAC  TGATCAAGTA GCGACCATAA ATATTTTCAC ACACATCACA TATTAGAGAG TGGGTGTATA AGACGACAAA AAAAAATTAG TCTCAAATAT ATATGTAGTT TTAATTTTGT GTAATTTAGG  GTTAATTAAC AGTACTAATT TAGCTTATTT GCTTCAGTTT GATGATTACA CTGGTTTACA ATTTAAATTA TGCTAATGAA GTTCGTTAAT GCATGGTAAT TACTATTAAG AAATCGATTT  AACCGGACCT TTAATTTTAT ACAGTCCGGG TCAGCTAATT CGATTCAATT TTTGATTGAA CATTTTGCCT TCAATTTTGC TTTCTGCAAC CCTATTATAA GATTAAAGGT CCGGTTAAAT  ATACAAAAGG GAGACTAGCA AGTTGTGGGA CAATTATTTA GACTTCTTCT CCTTTCACTT CCTTAAGTCA CATGCCATTA TTGGGGTCTA TCATATACTA TTACTACTTT TACATGTTGT  TTAACATTTT TCTTCTTGAT TTGATAATTG AGGCAAAAAC ATGTGGAAAA GTAAGGTCTT TTTACTATTC AAGTGTTCAC GGCAAATAAA TTTACTTGCT TTTGTCTCTG GCATAGTAGT  GGTTAATTAT AATTGAAATT GTAGGCTGAA ATCACCATAA ATTAGTTTGT TTAGTTTAAC ATTTACGTTT GAGACTAGTA TTAGTAGATA TTATACATGT AACATTCGCA TTTTATGATT  AAAACTATGG ATATTTTTAA TTTTTAATGA CATTTATTTT AGAAGTGTCT AATTAATTTT TAGTGATTTT TCATATATAT ATATATATAT ATATATATAT ATATTAATTT TAACTTCATT  TGCCATCTTA TATTTCTAAG TTTATTCCGT ATATACTATG TATATATCAA GTTTAATAAA CATTTGTAAA AAAATGATGT GTTTACTAAT AAGTAATAAC TACCTTACCG TTTTTAACAA  AACATATTTA TATATAGTCA TATAGACCGA AGAGGAGACT ATGTATATGA TACCTTGATG AGTGCATGTT AAAAGCAAAT AAGTAATTAA CGTCTTTTCT AAAGAAATAA TTTAATAAGT  GTATATATAT ACTGTCATAG CCCTTCTTTA TGATATATAT TAATGAACTG TTCACATGTG ATATTAATTA TTTAAGACCT GATATTTCTA TAAACTTTAT CCTTTTGCTT TCTTATATAG  AAATAAACTC TACATATATA TCTTTAGTTC TTTACTTCAT TTAGATGACC TCAAATTATT ATTTTTAATA AAGATAATCA TGGAGCTAAT AAAGGGAGGG TATAAGCTAT AAACTATAAA  CAAAGCTTTT TTTGTTCGGC TGTTTTTGGC TTCTCATTTT ATGAAATAAA TCTTTACCAT CAACAAATTA ACTAAAAATC ACAAAACTGA CACACACAAA AAAACACAAC ATTTTGTTCG  GCTTTTTTTT TCACTTCCTT TATTGTTTTA TTAAAAAAAA ATTTAGTTTA GTTTTTACAT AAGTTTTATA TTTACTTTCA CCATAATGAA CAATCCTCTT ATAAATAGAC CCCTTCCATT 
ATTGCTCTAT ATCCTGTCTC TCTTCAGTGA CACAAACCCA AAGAAAAGTA GTGAGAAACA AAATCGAGGT AACTACTAG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGCTTCAG GGTCGGAATG TGGTGTGTTA TGGTCATTGT TGTTTTGTGT GACTTTCGGA AAAAACAAAT GTTGTTAATT TAATTTTGTT GTTGTTTGAT TTGTGTTTAT GCACCCAAGA  ATGATGTGTT ATGGTTCAAT TAATATGTGA ATCATTTAAA TTTACAATAA TTCTTATTAT TCTGTATCTA GCCTTCTAAT CCAAGGTAAA TGAGTTTGAA ACTGTAAGAA ACTTTCGTGT  CTCCTTGAAT CCGGCATAGA TCTTTTCATT ATTTTCATAC ATTCACTAAG TTCATACACA AAACTTAAAA ATACATGTTC ACAGAAATAA AACAGCTTGA CAATGGCCCA TTATTCAGGC  CCATTATACA ACATTTTCAA TCGATTTCCC TAGCTTTCAG TTTCCGACCA AGCAATATTC TCCGTTACGT CTTGAATAAA TCTTTTCAAA GCAGTTTCTG ACGATCCACC GTCCATTAAA  GCCACGTGGC ACTTCTCGCT GATCTCATTC ACTCTCTTCC TGACGTCACT GTCTTGCTCC ATCAAACATA TGATTCCTTT CTCAATCTCC TCCGCCGTCA CAATCTCCGA CCTCCCCAAC  AAAAGATCTC CTCGCCAATG CTTCTTGATC TCCACAGCCA AACCAAGCTC TTCCACCATC TCGAAAGCGT TAAACTTCTG TTCAGCGTAA AGCGGCCAAA TCGCCATCGG AACACCAAAC  CACAAACTCT CCAACGTCGA ATTCCATCCG CCGTGAGAAA CAAAACCTCC GATCGCCGGC TTCGCCAATA TGGCCACCTG TTCAGCCCAT CCGATAACCT TTCCTCTGTT AGCCGTCCGA  TCGAAAAACC CTTCTGGGAG AATCTCCTCT AGGTTTGTGA ATTCTCCGGG AGGCTCTCTC AATATATTCG GAGATGCACG ACGGAGAGAC CAAAGAAACC GGTGGCCGCT TCGATCGAGA 
GCTAATGCGG TTTCTCTCAC TTGTTCCTCA CTGAACCCTC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGATGACGCAATTAAATATTGCGGTTGTGGTTGTAGTGACGGTTCTTATTGGAATGTTGAGATCATCGGAGGCTCAACTTCAAATGAATTTCTACGCGAAGAGCTGTCCAAAC
GCAGAGAAAATCATTTCAGATCATATTCAAAATCATATCCACAATGGTCCTTCTCTTGCAGCTCCTCTCATCCGAATGCACTTCCATGATTGCTTCGTTAGG
GTACTACATATATATAAA
TTAATAATCACACATTTATATTAACATATTTTATCCTCTTCTTATTTTTAATAAAAATGGTAATTTAGATAGTAAATTTGAGCTAGAGCAGAATATTTGAGATTTATTGCATTTTTTCAA
TATTGACACTGAACTTTTGTTTTTTAAGGGATGTGACGGATCGGTGTTGATAAATTCAACATCTGGTAACGCAGAGAGAGATGCACCACCGAATCTAACACTTAGAGGATTCGGTTTCGT
GGAAAGGATTAAGGCTCTTCTTGAAAAAGTGTGTCCTAAGACTGTTTCTTGCGCAGATATCATTGCTTTGACTGCTAGAGACGCAGTTGTCGCCACC
GTAAGTGTTACAAAACTATAAAC
TCGTGACTTAATTCATTAGTTACGCAAACTAATTGTAATTATAATCTAAAATTTGACAGGGAGGTCCTTCATGGAGTGTTCCAACGGGTAGAAGAGACGGTAGGATCTCAAATAAGACGG
AGGCTACTAATAACATTCCACCTCCAACGAGTAATTTCACGACTTTACAACGACTTTTCAAAAACCAAGGCCTTAATCTCAAGGACCTTGTTCTGCTCTCTG
GTACGTTCATTAACCCGA
AATAGCCAAATTGGTCTCCGGTAAGTTGTTATAACCGGTTTACTATTTTTTTTTTGTTCAGGGGCTCACACGATTGGCGTCTCACATTGTTCTTCCATGAATACGCGTCTCTACAACTTC
TCGACTACAGTAAAACAAGATCCATCTCTCGATAGCCAGTATGCAGCAAATCTAAAGGCTAACAAATGTAAGAGCCTTAACGACAATAGCACCATCCTCGAGATGGATCCCGGTAGTAGC
AGAAGCTTCGATCTCAGTTATTATAGGCTTGTCTTGAAGAGGAGAGGCTTGTTTCAGTCTGATTCTGCATTAACAACGAACTCAGCGACTTTGAAGGTGATCAACGACTTGGTCAACGGT
TCTGAAAAGAAGTTTTTCAAAGCTTTTGCTAAGTCAATGGAGAAGATGGGGAGAGTTAAAGTGAAGACTGGCTCAGCTGGTGTGATCAGGACACGGTGTTCTGTCGCTGGAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACGATGACGCAATTAAATATTGCGGTTGTGGTTGTAGTGACGGTTCTTATTGGAATGTTGAGATCATCGGAGGCTCAACTTCAAATGAATTTCTACGCGAAGAGCTGTCCAAAC
GCAGAGAAAATCATTTCAGATCATATTCAAAATCATATCCACAATGGTCCTTCTCTTGCAGCTCCTCTCATCCGAATGCACTTCCATGATTGCTTCGTTAGG
GGATGTGACGGATCGGTG
TTGATAAATTCAACATCTGGTAACGCAGAGAGAGATGCACCACCGAATCTAACACTTAGAGGATTCGGTTTCGTGGAAAGGATTAAGGCTCTTCTTGAAAAAGTGTGTCCTAAGACTGTT
TCTTGCGCAGATATCATTGCTTTGACTGCTAGAGACGCAGTTGTCGCCACC
GGAGGTCCTTCATGGAGTGTTCCAACGGGTAGAAGAGACGGTAGGATCTCAAATAAGACGGAGGCTACT
AATAACATTCCACCTCCAACGAGTAATTTCACGACTTTACAACGACTTTTCAAAAACCAAGGCCTTAATCTCAAGGACCTTGTTCTGCTCTCTG
GGGCTCACACGATTGGCGTCTCACAT
TGTTCTTCCATGAATACGCGTCTCTACAACTTCTCGACTACAGTAAAACAAGATCCATCTCTCGATAGCCAGTATGCAGCAAATCTAAAGGCTAACAAATGTAAGAGCCTTAACGACAAT
AGCACCATCCTCGAGATGGATCCCGGTAGTAGCAGAAGCTTCGATCTCAGTTATTATAGGCTTGTCTTGAAGAGGAGAGGCTTGTTTCAGTCTGATTCTGCATTAACAACGAACTCAGCG
ACTTTGAAGGTGATCAACGACTTGGTCAACGGTTCTGAAAAGAAGTTTTTCAAAGCTTTTGCTAAGTCAATGGAGAAGATGGGGAGAGTTAAAGTGAAGACTGGCTCAGCTGGTGTGATC
AGGACACGGTGTTCTGTCGCTGGAAGTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCCTGTCTC TCTTCAGTGA CACAAACCCA AAGAAAAGTA GTGAGAAACA AAATCGAGGT AACTACTAGA TGAAGACGAT GACGCAATTA AATATTGCGG TTGTGGTTGT AGTGACGGTT  CTTATTGGAA TGTTGAGATC ATCGGAGGCT CAACTTCAAA TGAATTTCTA CGCGAAGAGC TGTCCAAACG CAGAGAAAAT CATTTCAGAT CATATTCAAA ATCATATCCA CAATGGTCCT  TCTCTTGCAG CTCCTCTCAT CCGAATGCAC TTCCATGATT GCTTCGTTAG GGGATGTGAC GGATCGGTGT TGATAAATTC AACATCTGGT AACGCAGAGA GAGATGCACC ACCGAATCTA  ACACTTAGAG GATTCGGTTT CGTGGAAAGG ATTAAGGCTC TTCTTGAAAA AGTGTGTCCT AAGACTGTTT CTTGCGCAGA TATCATTGCT TTGACTGCTA GAGACGCAGT TGTCGCCACC  GGAGGTCCTT CATGGAGTGT TCCAACGGGT AGAAGAGACG GTAGGATCTC AAATAAGACG GAGGCTACTA ATAACATTCC ACCTCCAACG AGTAATTTCA CGACTTTACA ACGACTTTTC  AAAAACCAAG GCCTTAATCT CAAGGACCTT GTTCTGCTCT CTGGGGCTCA CACGATTGGC GTCTCACATT GTTCTTCCAT GAATACGCGT CTCTACAACT TCTCGACTAC AGTAAAACAA  GATCCATCTC TCGATAGCCA GTATGCAGCA AATCTAAAGG CTAACAAATG TAAGAGCCTT AACGACAATA GCACCATCCT CGAGATGGAT CCCGGTAGTA GCAGAAGCTT CGATCTCAGT  TATTATAGGC TTGTCTTGAA GAGGAGAGGC TTGTTTCAGT CTGATTCTGC ATTAACAACG AACTCAGCGA CTTTGAAGGT GATCAACGAC TTGGTCAACG GTTCTGAAAA GAAGTTTTTC  AAAGCTTTTG CTAAGTCAAT GGAGAAGATG GGGAGAGTTA AAGTGAAGAC TGGCTCAGCT GGTGTGATCA GGACACGGTG TTCTGTCGCT GGAAGTTAGT AAGCTTCAGG GTCGGAATGT  GGTGTGTTAT GGTCATTGTT GTTTTGTGTG ACTTTCGGAA AAAACAAATG TTGTTAATTT AATTTTGTTG TTGTTTGATT TGTGTTTATG CACCCAAGAA TGATGTGTTA TGGTTCAATT 
AATATGTGAA TCATTTAAAT TTACAATAAT TCTTATT 

Retrieve as FASTA