Entry information : ParcCIIBA04
Entry ID 12301
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2018-01-18 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-01-18 (Catherine Mathe)
Peroxidase information: ParcCIIBA04
Name ParcCIIBA04
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Polyporus
Organism Polyporus arcularius    [TaxId: 5639 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ParcCIIBA04
start..stop
S start..stop
GsppCIIBA04 563 0 1..361 1..358
ParcCIIBA06 557 0 17..361 16..358
GsppCIIBA09 554 0 1..361 1..358
GsppCIIBA08 554 0 1..361 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27697..27813 117 N° 2 27584..27627 44 N° 3 27487..27523 37 N° 4 27415..27423 9
N° 5 27303..27361 59 N° 6 27225..27238 14 N° 7 27126..27167 42 N° 8 26989..27067 79
N° 9 26627..26921 295 N° 10 26421..26565 145 N° 11 26182..26357 176 N° 12 26077..26116 40
N° 13 25987..26015 29  
complement(join(25987..26015,26077..26116,26182..26357,26421..26565,26627..26921 ,26989..27067,27126..27167,27225..27238,27303..27361,27415..27423,27487..27523,2 7584..27627,27697..27813))


exon

Literature and cross-references ParcCIIBA04
DNA ref. JGI genome:   scaffold_80 (27813..25987)
Cluster/Prediction ref. JGI gene:   484531
Protein sequence: ParcCIIBA04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (342)
PWM (Da):   %s   37384.59 (35442.5)  
PI (pH):   %s   4.36 (4.31) Peptide Signal:   %s   cut: 20 range:20-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSKTLLAIAALAVAAVTAAPSGKGQVSCKHGRKAANAACCVWFDVLDDIQTNLFDGGECGEEVHSLRLTFHDAIGFSPALFAQGKFGGNGDGSIMSFAEIETAFHANGGIDDIVEAQRPFALAHGVSFGDFIQFAGAVGVSNCAGGPRLQFLAGRSNVTQPSPDLLVPEPSDSVDTILARMGDAGFSPNEVVDLLISHTVAAQDHVDPTIPGTPFDSTPGSFDSQFFITLLKGVLFPGNGSNPGEVLSPLAGELRLFSDGELARDSRTACEWQSFITDHSSMVSKFEAVMSKLAVLGQNPRNLVDCSDIIPVPANTKLPPPTLPAGKSLADVEVCAATPFPAISAAPGPATTIAPV

Retrieve as FASTA  
Remarks complete sequence from genomics (12 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCCAAGACGCTCCTAGCCATCGCTGCTCTCGCCGTCGCCGCGGTCACGGCTGCCCCCAGCGGCAAGGGTCAAGTTTCGTGCAAGCACGGTCGCAAGGCCGCTAACGCTGCGGTA
CGCCTCTTTGTTCATACTGCAAGTTTCTTACTAGTGGTCCGATTCTGACGGGCATCGCGGTGACAGTGCTGTGTCTGGTTTGACGTCTTGGACGACATCCAAACGAACCTGTGAGGCTCA
TTTATTGGTGGCGGTGGCGTTGCCGGCATTTTGACCTCACTACTCGCCAGATTCGACGGTGGAGAGTGCGGTGAGGAAGTTCATGAGGTGAGCAGAGAGTCAAAACATGCGTGATGATGG
TGTGCCGTCGGCTGACTTGCTGCTCCACAGTCACTTCGTGTAAGTACTTGGTGATTAGTATGCGGTGCGAAGTGGCTAATCACTGCCGTCAGCTCACCTTCCATGATGCCATCGGGTTTT
CTCCGGCCCTTTTCGCTCAGGGCAAGTTTGG
GTGCGTCGTATCCACCCGCTTAACCACTCGCAGGCATGTAAACTGAAGAAAATCTCGCTAACAGAGGCAATGGCGCCGGTGAGGACGAG
TTGCTACGGTGATCCGCCGTGCACGCACTGACAGGAACTGTCTCAGACGGTTCCATCATGTCCTTTGCCGAAATCGAGACTGCCTTCCGTGAGTTCCTCATCTCGTGGGCTGCAACAAAT
AGGTGCTTACGCATGAATGTTGGAAGACGCCAACGGCGGCATCGACGATATCGTCGAGGCTCAACGCCCCTTCGCACTGGCCCACGGCGTCTCCTTCGGTGACTTGTGCGTCCCATCCCG
TATCTCTAAACTGTAACATCAATTGAGCTGATCCCACGCCCACACACAACAGCATCCAGTTCGCCGGCGCCGTCGGCGTGTCGAACTGCGCTGGCGGGCCGCGCCTGCAGTTCCTCGCCG
GTCGCTCCAACGTTACCCAGCCCTCGCCCGACCTGCTCGTCCCGGAGCCGTCCGACAGCGTCGACACCATACTCGCGCGCATGGGCGATGCCGGATTCAGCCCCAACGAGGTCGTCGACC
TACTCATCTCTCACACCGTCGCGGCCCAGGACCACGTCGACCCTACTATTCCCGGCACGCCATTCGACTCGACGCCCGGCTCCTTCGACTCGCAGTTCTTCATCGAG
GTCAGTATTCGAA
CACGGGTGAACTTTGTATAGTCGTGTTGACGGCCTGGGTCGCGTACAGACTCTTTTGAAGGGCGTGCTTTTCCCTGGGAACGGTTCCAACCCAGGCGAGGTCCTCTCTCCGCTTGCCGGT
GAACTCCGTCTCTTCTCGGACGGCGAGCTTGCCCGGGATTCGCGCACGGCCTGCGAGTGGCAGTCGTTCATCA
GTAAGCTCTCCGGTGACCCTACCCTGTACTTCCGTCTGACACAAAAC
CTCTACATCCGCGCAGCGGACCACAGCTCCATGGTTTCGAAGTTCGAAGCGGTGATGTCCAAGCTGGCGGTCCTCGGCCAGAACCCGCGCAACCTCGTCGACTGCTCGGATATCATCCCC
GTCCCGGCCAACACGAAGCTCCCGCCTCCCACCCTCCCGGCCGGCAAGTCCCTTGCGGATGTTGAGGTTGCT
GTGCGTCACGGCTCTCTTCTGCGTGTGCGATGCGTGCTTGACGGCTTA
CACTGCTTGGGGTTTAGTGCGCTGCCACTCCGTTCCCTGCTATCAGCGCAGCTCCCGGTATGTGAATCCGTATGTTTTCAAGAAACGTTGACTCATTTGTTAATCCTTACTCGTTTAGGC
CCCGCCACCACCATTGCGCCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCCAAGACGCTCCTAGCCATCGCTGCTCTCGCCGTCGCCGCGGTCACGGCTGCCCCCAGCGGCAAGGGTCAAGTTTCGTGCAAGCACGGTCGCAAGGCCGCTAACGCTGCGTGC
TGTGTCTGGTTTGACGTCTTGGACGACATCCAAACGAACCT
ATTCGACGGTGGAGAGTGCGGTGAGGAAGTTCATGAGTCACTTCGTCTCACCTTCCATGATGCCATCGGGTTTTCTCCG
GCCCTTTTCGCTCAGGGCAAGTTTGG
AGGCAATGGCGCCGACGGTTCCATCATGTCCTTTGCCGAAATCGAGACTGCCTTCCACGCCAACGGCGGCATCGACGATATCGTCGAGGCTCAA
CGCCCCTTCGCACTGGCCCACGGCGTCTCCTTCGGTGACTT
CATCCAGTTCGCCGGCGCCGTCGGCGTGTCGAACTGCGCTGGCGGGCCGCGCCTGCAGTTCCTCGCCGGTCGCTCCAAC
GTTACCCAGCCCTCGCCCGACCTGCTCGTCCCGGAGCCGTCCGACAGCGTCGACACCATACTCGCGCGCATGGGCGATGCCGGATTCAGCCCCAACGAGGTCGTCGACCTACTCATCTCT
CACACCGTCGCGGCCCAGGACCACGTCGACCCTACTATTCCCGGCACGCCATTCGACTCGACGCCCGGCTCCTTCGACTCGCAGTTCTTCATCGAG
ACTCTTTTGAAGGGCGTGCTTTTC
CCTGGGAACGGTTCCAACCCAGGCGAGGTCCTCTCTCCGCTTGCCGGTGAACTCCGTCTCTTCTCGGACGGCGAGCTTGCCCGGGATTCGCGCACGGCCTGCGAGTGGCAGTCGTTCATC
A
CGGACCACAGCTCCATGGTTTCGAAGTTCGAAGCGGTGATGTCCAAGCTGGCGGTCCTCGGCCAGAACCCGCGCAACCTCGTCGACTGCTCGGATATCATCCCCGTCCCGGCCAACACG
AAGCTCCCGCCTCCCACCCTCCCGGCCGGCAAGTCCCTTGCGGATGTTGAGGTTGCT
TGCGCTGCCACTCCGTTCCCTGCTATCAGCGCAGCTCCCGGCCCCGCCACCACCATTGCGCCC
GTGTAA

Retrieve as FASTA