Entry information : LsulGPx01
Entry ID 12309
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: LsulGPx01
Name LsulGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Laetiporus
Organism Laetiporus sulphureus    [TaxId: 5630 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LsulGPx01
start..stop
S start..stop
TcamGPx 291 4e-103 1..159 1..159
WcoGPx01 288 3e-102 1..159 1..159
GtraGPx01 290 8e-102 1..159 62..220
DqueGPx01 286 2e-101 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 548861..548967 107 N° 2 548774..548796 23 N° 3 548645..548712 68 N° 4 548402..548575 174
N° 5 548233..548340 108  
complement(join(548233..548340,548402..548575,548645..548712,548774..548796,5488 61..548967))


exon

Literature and cross-references LsulGPx01
Cluster/Prediction ref. JGI gene:   724768
Protein sequence: LsulGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17765.12  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFYELKAELPGGKTYDFEQLKGKVVLIVNVASKCGFTPQYGLQKLYDKYKDQGFLILGFPCNFGGQEPGDDAAIKEFCTLNHGVTFPLMKKSDVNGDNTNEVFKYLKSQKSGLLGLTRIKWNFEKFLVDRSGKVVGRWASTTSPDALDEEIAKLL*

Retrieve as FASTA  
Remarks complete sequence from genomics (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCGTTCTATGAGCTGAAAGCTGAGCTTCCGGGCGGGAAGACGTATGACTTTGAACAGTTGAAGGGAAAGGTCGTGTTGATCGTGAACGTTGCATCCAAGTGGTACGTCTCTCAG
TTCTTTCGCGATGGTGAATGGTCGCTCACGATGGACGTCTCCTACGTGTAGTGGATTCACCCCGCAGTATACTGGTAACTACAGAAAGCTCGCGTCAGCTCAGTGAGGATGGGAGGGCTC
ATAGGTGATTGCCAGGTCTGCAGAAGCTGTACGACAAGTATAAGGACCAGGGATTCCTCATCCTCGGCTTCCCCTGCAATCAGGTCCGTGTCCATCTTCCCATGCGGGATAACCATCGCG
TGTATATTACTTGTGCTGACCGCTTGCTCCAGTTCGGCGGACAAGAGCCCGGCGACGACGCTGCCATTAAGGAGTTCTGCACGCTCAACCACGGCGTCACCTTCCCGCTCATGAAGAAGT
CGGATGTGAACGGGGACAACACGAACGAGGTGTTCAAGTATCTCAAGAGCCAGAAGTCTGGCCTGTTGGGCTTGACGCGAATCAAG
GTCAGTCTGTCATCTGCACGAATGCCTTGCTCGC
TCGCTCATGAATGCTCCCCTCTCATAGTGGAACTTTGAGAAGTTCCTCGTTGATCGGAGTGGCAAGGTCGTCGGCCGCTGGGCGTCGACCACCTCTCCCGACGCCCTCGACGAGGAGATC
GCGAAGCTGTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCGTTCTATGAGCTGAAAGCTGAGCTTCCGGGCGGGAAGACGTATGACTTTGAACAGTTGAAGGGAAAGGTCGTGTTGATCGTGAACGTTGCATCCAAGTGTGGATTCACCCCG
CAGTATACTG
GTCTGCAGAAGCTGTACGACAAGTATAAGGACCAGGGATTCCTCATCCTCGGCTTCCCCTGCAATCAGTTCGGCGGACAAGAGCCCGGCGACGACGCTGCCATTAAGGAG
TTCTGCACGCTCAACCACGGCGTCACCTTCCCGCTCATGAAGAAGTCGGATGTGAACGGGGACAACACGAACGAGGTGTTCAAGTATCTCAAGAGCCAGAAGTCTGGCCTGTTGGGCTTG
ACGCGAATCAAG
TGGAACTTTGAGAAGTTCCTCGTTGATCGGAGTGGCAAGGTCGTCGGCCGCTGGGCGTCGACCACCTCTCCCGACGCCCTCGACGAGGAGATCGCGAAGCTGTTGTGA

Retrieve as FASTA