Entry information : NlepCcP01
Entry ID 12313
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: NlepCcP01
Name NlepCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Gloeophyllaceae Neolentinus
Organism Neolentinus lepideus    [TaxId: 38799 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NlepCcP01
start..stop
S start..stop
GtraCcP 694 0 1..377 1..378
JargCcP 582 0 1..367 1..368
SlacCcP01 571 0 1..373 1..370
AthiCcP01 560 0 1..373 1..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189715..190017 303 N° 2 189614..189662 49 N° 3 189482..189563 82 N° 4 189270..189423 154
N° 5 189080..189213 134 N° 6 188963..189028 66 N° 7 188763..188912 150 N° 8 188612..188695 84
N° 9 188446..188557 112  
complement(join(188446..188557,188612..188695,188763..188912,188963..189028,1890 80..189213,189270..189423,189482..189563,189614..189662,189715..190017))


exon

Literature and cross-references NlepCcP01
DNA ref. JGI genome:   scaffold_57 (190017..188446)
Cluster/Prediction ref. JGI gene:   1099387
Protein sequence: NlepCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378
PWM (Da):   %s   41741.5 Transmb domain:   %s   o44-66i
PI (pH):   %s   7.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSMLRAPVCKAAFSAVSPPRLAARNQFRKYATGPSASTDSKTGFWGAIGAGVAIAGGIAYYVLNSNSDTAREAQTTLKHGAQAAKAAANFTPTKDDYQKVYNKIAEVMDEAGEYDDGSFGPVLVRLAWHCSGTYDKASNTGGSNFATMRFEPESLHGGNKGLHIARGVMEGIKKDFPWISYGDLWTLGGVCAIEMQGPKIPWRSGRIDGFDKDCTPDGRLPDGSQGADHLRSIFYRMGFNDQEIVALSGAHALGRCHSDRSGFEGPWTFSPTTVTNDYYKLLFEEKWVWRKWNGPKQLADKKTGTLMMLPTDYVLTQDKSFKKYAKAYADDQELWFKDFAKVFSQLLELGVPENQWATTEPWIMKTIDEQSESK

Retrieve as FASTA  
Remarks complete sequence from genomics (8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCTCGATGCTTCGGGCACCCGTATGCAAGGCTGCTTTCTCTGCTGTCTCTCCTCCCAGGTTGGCTGCGAGAAACCAGTTCCGTAAATATGCGACTGGTCCCTCTGCATCTACC
GATTCCAAGACCGGTTTCTGGGGCGCAATTGGTGCTGGGGTCGCCATTGCAGGCGGTATCGCCTACTATGTCCTGAACAGTAACTCTGACACCGCTCGAGAGGCGCAGACCACTCTCAAG
CACGGTGCTCAGGCTGCTAAGGCTGCAGCCAACTTCACACCGACCAAGGATGACTACCAAAAG
GTTTGTCTCTCTACTGACGCGGAGGAGCTTCATGTGTTAAAGTGGATTCTAGGTTTA
CAACAAGATCGCTGAGGTGATGGACGAGGCCGGCGAATACGACG
GTAAGCATGACTACGTCGCCTCCACCGGTTCAGTCTTCATTATTTTGTAGACGGTTCCTTCGGCCCCGTTCTCGTT
CGTCTGGCATGGCACTGCTCTGGTACATACGACAAGGCTTCAAACACCGGCGGAAG
GTTAGCGCACTCACTGTTTTCTCAACTACGCCACATAATGACCTTCGACGACTTTTAGCAACTT
CGCTACCATGCGGTTCGAGCCCGAGTCTCTCCACGGTGGTAACAAGGGTCTTCACATTGCTCGTGGTGTGATGGAGGGTATAAAGAAGGACTTCCCCTGGATCAGCTACGGTGACCTCTG
GACTCTCGGCGGCGTCTGCGCCATTCAA
GTACGGGTTATGAAACCAAATAAAATAAGTAGCCCACTGATCCTGATGCCGTGTAGGAAATGCAAGGTCCCAAGATCCCATGGAGGTCCGGG
CGTATCGACGGTTTCGATAAGGACTGTACTCCGGACGGTCGTCTCCCCGATGGTTCACAGGGTGCTGACCACTTGCGAAGCATTTTCTACCGCATGGG
GTGAGTCTGAATCTCATCTCAA
ATAAAAGGTTCTCTAACACAGTTGGATAGTTTCAATGACCAGGAAATCGTCGCGCTCTCTGGTGCTCACGCTCTTGGACGTTGCCACTCTGACCGGTATGTGGCAACGTGTATAAACTCC
GTCTTCGTCGTTCATTTCTTTCTAGCTCTGGCTTCGAAGGACCTTGGACTTTCTCCCCGACGACCGTGACCAACGACTACTATAAGCTCCTGTTCGAGGAGAAGTGGGTATGGAGGAAGT
GGAATGGCCCCAAACAGCTCGCGGACAAGAAGACCGGTACCCTCATGATGCTGCC
GTAAGTAATACTTCCTGGCCTTTGCAGAATTTTTGGACCGCTAAAATTTTGCTCTTTTCCTCCGC
AGTACGGACTATGTACTTACTCAGGACAAGAGCTTCAAGAAGTACGCCAAGGCCTACGCTGATGACCAGGAGCTGTGGTTCAAGGAGTAAGCATGTTCGTCATGGCGCCCTAGGATCAGC
TCGCATTAACCGTATGACAGCTTCGCCAAGGTCTTCTCCCAGCTGCTTGAGCTCGGTGTCCCCGAGAACCAGTGGGCTACCACTGAGCCTTGGATCATGAAGACCATCGACGAGCAGTCG
GAGTCTAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCTCGATGCTTCGGGCACCCGTATGCAAGGCTGCTTTCTCTGCTGTCTCTCCTCCCAGGTTGGCTGCGAGAAACCAGTTCCGTAAATATGCGACTGGTCCCTCTGCATCTACC
GATTCCAAGACCGGTTTCTGGGGCGCAATTGGTGCTGGGGTCGCCATTGCAGGCGGTATCGCCTACTATGTCCTGAACAGTAACTCTGACACCGCTCGAGAGGCGCAGACCACTCTCAAG
CACGGTGCTCAGGCTGCTAAGGCTGCAGCCAACTTCACACCGACCAAGGATGACTACCAAAAG
GTTTACAACAAGATCGCTGAGGTGATGGACGAGGCCGGCGAATACGACGACGGTTCC
TTCGGCCCCGTTCTCGTTCGTCTGGCATGGCACTGCTCTGGTACATACGACAAGGCTTCAAACACCGGCGGAAG
CAACTTCGCTACCATGCGGTTCGAGCCCGAGTCTCTCCACGGTGGT
AACAAGGGTCTTCACATTGCTCGTGGTGTGATGGAGGGTATAAAGAAGGACTTCCCCTGGATCAGCTACGGTGACCTCTGGACTCTCGGCGGCGTCTGCGCCATTCAA
GAAATGCAAGGT
CCCAAGATCCCATGGAGGTCCGGGCGTATCGACGGTTTCGATAAGGACTGTACTCCGGACGGTCGTCTCCCCGATGGTTCACAGGGTGCTGACCACTTGCGAAGCATTTTCTACCGCATG
GG
TTTCAATGACCAGGAAATCGTCGCGCTCTCTGGTGCTCACGCTCTTGGACGTTGCCACTCTGACCGCTCTGGCTTCGAAGGACCTTGGACTTTCTCCCCGACGACCGTGACCAACGAC
TACTATAAGCTCCTGTTCGAGGAGAAGTGGGTATGGAGGAAGTGGAATGGCCCCAAACAGCTCGCGGACAAGAAGACCGGTACCCTCATGATGCTGCC
TACGGACTATGTACTTACTCAG
GACAAGAGCTTCAAGAAGTACGCCAAGGCCTACGCTGATGACCAGGAGCTGTGGTTCAAGGA
CTTCGCCAAGGTCTTCTCCCAGCTGCTTGAGCTCGGTGTCCCCGAGAACCAGTGGGCT
ACCACTGAGCCTTGGATCATGAAGACCATCGACGAGCAGTCGGAGTCTAAGTAA

Retrieve as FASTA