Entry information : NlepGPx01
Entry ID 12314
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: NlepGPx01
Name NlepGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Gloeophyllaceae Neolentinus
Organism Neolentinus lepideus    [TaxId: 38799 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NlepGPx01
start..stop
S start..stop
GtraGPx01 331 4e-117 1..216 1..220
PstrGPx01 307 4e-107 19..216 62..254
DqueGPx01 292 1e-102 60..216 3..159
FpinGPx01 292 2e-101 1..216 9..228
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 458162..458439 278 N° 2 458497..458519 23 N° 3 458577..458644 68 N° 4 458696..458869 174
N° 5 458937..459041 105  
join(458162..458439,458497..458519,458577..458644,458696..458869,458937..459041)


exon

Literature and cross-references NlepGPx01
DNA ref. JGI genome:   scaffold_3 (458330..459041)
Cluster/Prediction ref. JGI gene:   1055336
Protein sequence: NlepGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   24178.55  
PI (pH):   %s   10
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRRLPSLLIRLRPLSFVTRSSAQRFAPAHPYYKSLSARLPSRTYATTRVSDPQPTMAQTFYDLKAELPGGKTLDFADLKGKVVLIVNTASQCGFTPQYGLQKLYEKYKDKDFVILGFPCNFGGQEPGDDSAISEFCTLNHGVSFPLMKKSDVNGDNTNEVYKWLKSQKAGILGLTRIKWNFEKFLIDKNGNVVNRWASTTTPDAIDAEVAKLV

Retrieve as FASTA  
Remarks complete sequence from genomic (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCGACGGTTACCCTCATTACTCATCAGATTGCGACCCCTCTCTTTTGTAACTCGTTCGTCTGCGCAACGCTTCGCCCCTGCTCATCCATATTACAAGTCTCTGAGTGCCCGCTTA
CCCTCAAGGACGTACGCTACCACTCGTGTCAGTGACCCGCAGCCTACGATGGCGCAAACATTTTACGACCTGAAGGCGGAGTTGCCCGGAGGGAAGACGCTGGACTTTGCGGACTTGAAA
GGCAAGGTCGTGTTGATTGTCAATACGGCGTCGCAGTG
GTACGTTCATAGTCTGTCTGAGGTAGTATCATCGGTTGATCGGGTTGCGACACGAAGTGGTTTCACGCCCCAGTACAAGGGT
AGGCTTCCAACATCATGACCATCTACTAGATAGCTCGTGACTTATGGATCGCTAGGCTTGCAGAAGCTCTATGAGAAGTACAAGGATAAAGACTTTGTCATCCTCGGCTTTCCCTGCAAC
CAG
GTAGGCAGCTCATTCACTTCTCATTTCCCGCTCTTACCCCATCGATCATAGTTTGGCGGCCAGGAACCCGGCGACGACAGCGCTATATCCGAATTCTGCACGCTCAATCATGGCGTC
TCCTTCCCTTTGATGAAGAAGTCCGACGTCAATGGCGACAACACGAACGAGGTGTACAAATGGCTGAAGTCGCAGAAGGCGGGCATCCTGGGTCTGACGAGAATCAAG
GTGCGCTCAGCA
TATTTCTAGTCCTAATGAAAAGACCATATCGCTGAACGACTTTATCGGACGGCAGTGGAACTTCGAGAAGTTCTTGATTGATAAGAACGGAAACGTCGTCAACCGCTGGGCGTCGACGAC
TACCCCTGATGCGATTGACGCAGAGGTTGCCAAGCTTGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCGACGGTTACCCTCATTACTCATCAGATTGCGACCCCTCTCTTTTGTAACTCGTTCGTCTGCGCAACGCTTCGCCCCTGCTCATCCATATTACAAGTCTCTGAGTGCCCGCTTA
CCCTCAAGGACGTACGCTACCACTCGTGTCAGTGACCCGCAGCCTACGATGGCGCAAACATTTTACGACCTGAAGGCGGAGTTGCCCGGAGGGAAGACGCTGGACTTTGCGGACTTGAAA
GGCAAGGTCGTGTTGATTGTCAATACGGCGTCGCAGTG
TGGTTTCACGCCCCAGTACAAGGGCTTGCAGAAGCTCTATGAGAAGTACAAGGATAAAGACTTTGTCATCCTCGGCTTTCCC
TGCAACCAG
TTTGGCGGCCAGGAACCCGGCGACGACAGCGCTATATCCGAATTCTGCACGCTCAATCATGGCGTCTCCTTCCCTTTGATGAAGAAGTCCGACGTCAATGGCGACAACACG
AACGAGGTGTACAAATGGCTGAAGTCGCAGAAGGCGGGCATCCTGGGTCTGACGAGAATCAAG
TGGAACTTCGAGAAGTTCTTGATTGATAAGAACGGAAACGTCGTCAACCGCTGGGCG
TCGACGACTACCCCTGATGCGATTGACGCAGAGGTTGCCAAGCTTGTA

Retrieve as FASTA