Entry information : ApulCIIAA01
Entry ID 12366
Creation 2013-06-03 (Nizar Fawal)
Last sequence changes 2017-05-19 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-19 (Catherine Mathe)
Peroxidase information: ApulCIIAA01
Name ApulCIIAA01
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Dothioraceae Aureobasidium
Organism Aureobasidium pullulans    [TaxId: 5580 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApulCIIAA01
start..stop
S start..stop
GsteCIIAA01 445 4e-157 22..370 20..370
LfluCIIAA03 441 2e-155 21..370 19..371
BdotCIIAA02 412 3e-144 23..370 21..364
DserCIIAA 404 6e-141 1..370 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1524558..1525062 505 N° 2 1525119..1525453 335 N° 3 1525512..1525670 159 N° 4 1525723..1525863 141
join(1524558..1525062,1525119..1525453,1525512..1525670,1525723..1525863)


exon

Literature and cross-references ApulCIIAA01
DNA ref. JGI genome:   scaffold_3 (1524558..1525863)
Cluster/Prediction ref. JGI gene:   332454 [Incorrect prediction]
Protein sequence: ApulCIIAA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   379 (356)
PWM (Da):   %s   40129.04 (37565.6)  
PI (pH):   %s   7.2 (6.62) Peptide Signal:   %s   cut: 24 range:24-379
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSLVAPLFAFVALNLNAHVQAWPAMAQHAAALSRRAPQDLIVDNDIVRIGLGDVKNGGTTPVGTSVYNILMGTEAGDSDAAGYKPPGIVGTKACKADTCCVWWWIAQAMTVAFTGPTGRCNGFARAAIRLGFHDAGSWSSSLAAAGQDFGGADGSIVLSGTEINRADNNGLQAIANQALIWSKLFNVGVADIIQFGAKHAVVTCPLGPRTRVFVGRKDSKKAAPEGLMPSVSMSADQIISLFEDKTIQPHDLAALLGAHSTSQQFNVDKTKAGFGQDSTPGVWDVSFYNETLQPGTNSKVFKFQSDLVTANDSRVSDEWHAFIGDQSHWNGDYASAYVRLSMLGVNNINNLTECTQVMPAAKKTFAGASTPGLFGRS*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns). Incorrect prediction from JGI (signal peptide missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTCTCTCTGGTGGCACCTCTCTTTGCTTTTGTTGCGCTGAATCTCAATGCACATGTTCAAGCATGGCCAGCAATGGCGCAACATGCAGCCGCACTGTCTCGTCGCGCGCCTCAA
GACCTTATTGTCGACAATGACATTGTGCGGATAGGTCTTGGCGATGTCAAGAACGGCGGCACCACACCCGTCGGCACAAGTGTCTACAACATCCTCATGGGAACAGAAGCTGGCGATTCG
GATGCGGCTGGATACAAGCCACCAGGCATAGTTGGTACCAAGGCATGTAAGGCTGACACATGCTGCGTCTGGTGGTGGATAGCTCAGGCGATGACTGTTGCCTTCACTGGACCTACCGGT
CGATGCAATGGCTTCGCTCGTGCAGCCATACGCTTGGGCTTTCACGATGCAGGGTCATGGTCAAGCTCTCTTGCCGCTGCTGGTCAAGACTTTGGTGGAGCTGATGGAAGCATTGTCTTA
TCAGGCACAGAGATCAATAGAGCAG
GTTTGTACTCGCCATCCTATGCAAGCTTTAGTTACAAGCACTGACAAGACTCACAGACAACAACGGCCTGCAAGCCATTGCCAACCAAGCTTTAA
TCTGGTCTAAGCTGTTCAATGTCGGTGTAGCCGATATCATCCAGTTTGGAGCTAAGCATGCCGTTGTCACCTGTCCCTTAGGTCCACGCACCCGTGTGTTCGTTGGCCGCAAGGATAGTA
AGAAGGCTGCTCCTGAAGGCTTGATGCCTTCGGTCTCCATGAGCGCAGACCAAATCATCAGCCTCTTCGAGGACAAGACCATTCAGCCTCATGATCTTGCTGCTCTCCTTGGTGCACACA
GTACTAGCCAGCAATTCAACGTCGACAAGACAAAGGCTGGCTTCGGTCAAGATTCG
GTAAGCACTGAGAATTCGCTTTCGCATGCCCAGTCAAGACAGCTGACACATTCAATAGACACCT
GGTGTATGGGACGTCTCATTCTACAACGAGACTCTGCAGCCAGGTACAAACAGCAAGGTCTTCAAGTTCCAAAGCGACCTTGTCACGGCGAACGATTCGCGCGTAAGCGATGAATGGCAT
GCTTTCATCGGAGATCAGAGCCATTGGAATGGG
GTAAGTCTTCCCGCGTCACAGGCCGTTCTTCAAATGCTAACAATGTTCACAGGACTACGCCTCCGCTTATGTCAGACTGAGCATGCT
TGGAGTAAACAACATCAACAATCTGACGGAATGTACACAAGTCATGCCAGCTGCGAAGAAGACGTTCGCTGGAGCATCGACACCGGGTCTCTTTGGCAGATCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTCTCTCTGGTGGCACCTCTCTTTGCTTTTGTTGCGCTGAATCTCAATGCACATGTTCAAGCATGGCCAGCAATGGCGCAACATGCAGCCGCACTGTCTCGTCGCGCGCCTCAA
GACCTTATTGTCGACAATGACATTGTGCGGATAGGTCTTGGCGATGTCAAGAACGGCGGCACCACACCCGTCGGCACAAGTGTCTACAACATCCTCATGGGAACAGAAGCTGGCGATTCG
GATGCGGCTGGATACAAGCCACCAGGCATAGTTGGTACCAAGGCATGTAAGGCTGACACATGCTGCGTCTGGTGGTGGATAGCTCAGGCGATGACTGTTGCCTTCACTGGACCTACCGGT
CGATGCAATGGCTTCGCTCGTGCAGCCATACGCTTGGGCTTTCACGATGCAGGGTCATGGTCAAGCTCTCTTGCCGCTGCTGGTCAAGACTTTGGTGGAGCTGATGGAAGCATTGTCTTA
TCAGGCACAGAGATCAATAGAGCAG
ACAACAACGGCCTGCAAGCCATTGCCAACCAAGCTTTAATCTGGTCTAAGCTGTTCAATGTCGGTGTAGCCGATATCATCCAGTTTGGAGCTAAG
CATGCCGTTGTCACCTGTCCCTTAGGTCCACGCACCCGTGTGTTCGTTGGCCGCAAGGATAGTAAGAAGGCTGCTCCTGAAGGCTTGATGCCTTCGGTCTCCATGAGCGCAGACCAAATC
ATCAGCCTCTTCGAGGACAAGACCATTCAGCCTCATGATCTTGCTGCTCTCCTTGGTGCACACAGTACTAGCCAGCAATTCAACGTCGACAAGACAAAGGCTGGCTTCGGTCAAGATTCG
ACACCTGGTGTATGGGACGTCTCATTCTACAACGAGACTCTGCAGCCAGGTACAAACAGCAAGGTCTTCAAGTTCCAAAGCGACCTTGTCACGGCGAACGATTCGCGCGTAAGCGATGAA
TGGCATGCTTTCATCGGAGATCAGAGCCATTGGAATGGG
GACTACGCCTCCGCTTATGTCAGACTGAGCATGCTTGGAGTAAACAACATCAACAATCTGACGGAATGTACACAAGTCATG
CCAGCTGCGAAGAAGACGTTCGCTGGAGCATCGACACCGGGTCTCTTTGGCAGATCATAG

Retrieve as FASTA