Entry information : ApulCIIAC01
Entry ID 12369
Creation 2013-06-03 (Nizar Fawal)
Last sequence changes 2017-05-02 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-02 (Catherine Mathe)
Peroxidase information: ApulCIIAC01
Name ApulCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Dothioraceae Aureobasidium
Organism Aureobasidium pullulans    [TaxId: 5580 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApulCIIAC01
start..stop
S start..stop
ApulCIIAC02 365 5e-127 17..307 52..346
ApruCIIAC01 354 1e-122 18..307 74..362
BdotCIIAC02 314 3e-107 15..307 48..340
MgCIIAC01 303 6e-103 16..305 35..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 186871..187042 172 N° 2 186582..186817 236 N° 3 186330..186528 199 N° 4 186123..186278 156
N° 5 185909..186069 161  
complement(join(185909..186069,186123..186278,186330..186528,186582..186817,1868 71..187042))


exon

Literature and cross-references ApulCIIAC01
DNA ref. JGI genome:   scaffold_20 (187042..185909)
Cluster/Prediction ref. JGI gene:   280127
Protein sequence: ApulCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   307 (290)
PWM (Da):   %s   32285.82 (30298.8)  
PI (pH):   %s   5.01 (4.99) Peptide Signal:   %s   cut: 18 range:18-307
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFAKTFALFAFTALAEASGSCPAIWSTVASDLSQSFIGSNGCTDLARGAIRFAFHDSASYSSKTQYYAPATGGADGSLLLSSVEITRDENNGLQSYYGFLQEKYSKYKSQVGAADLVQFAASVAIVSCPGGPKVPTVVGRKDTSTAAPDNLLPKAFGAGAAQQVLIQLFEDKGISQPELAALIGAHTASKAVAQEAYGVPYNGPQDSTPGQWDVKYYSDTDNHPSGVYSFESDVNLSNPNSTVGQTFQSFVNSQSKWNAAFAPAMAHLSVLGISQADQANFVDCTSAVPSGSNARMIRAAPINDRIR*

Retrieve as FASTA  
Remarks complete sequence from genomics (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCGAAGACTTTCGCTCTCTTTGCCTTCACGGCTCTTGCTGAGGCATCAGGCAGTTGTCCTGCTATCTGGTCGACCGTGGCCTCAGATCTTTCACAATCATTCATCGGCAGCAAC
GGATGTACCGATCTCGCCCGAGGCGCCATCCGTTTCGCCTTCCACGATTCTG
GTATGTGTATTGTATCAGAGGTACAGGTCAGCATCTACTAACAGTTCCTGCAGCGTCATATTCTTCCA
AAACACAATACTATGCACCTGCTACTGGTGGCGCTGATGGATCGCTCCTCCTGAGTTCTGTGGAGATCACTCGAGATGAGAACAATGGTCTTCAGTCATACTACGGTTTCCTCCAGGAGA
AGTACTCCAAGTACAAGTCTCAAGTCGGTGCTGCAGACTTGGTCCAATTCGCCGCTAGTGTGGCAATTGTCAGCTGTCCTGGAGGCCCCAAGGTCCCTACG
GTATGGAAATGAAAGGTTT
GCTCTACAGATGACAGCGACTGATATGCGTCTAGGTTGTTGGCCGAAAGGATACCAGTACTGCAGCACCGGACAATCTCCTGCCGAAAGCCTTCGGCGCAGGCGCTGCGCAACAAGTGCT
AATCCAACTGTTCGAGGACAAGGGAATCAGTCAACCAGAGCTTGCTGCTTTGATTGGCGCACACACTGCATCAAAGGCTGTGGCTCAAGAGGCCTACGGTGTTCCTTACAATG
GTAAATT
CATTGTACGCAAGACATTGACCGGTATCTAACAAACATGTCCAGGTCCTCAAGATTCCACACCTGGTCAGTGGGACGTGAAATACTACTCCGACACGGACAATCACCCCAGTGGTGTCTA
CAGCTTTGAATCAGATGTCAACCTTTCAAACCCCAACTCGACTGTAGGCCAGACTTTCCAGAGCTTCGTCAACAGTCAGA
GTGAGTATATATGCGGCTTCTCAATGCTTATCAAAAACTA
ACAACATGTTCAGGCAAATGGAATGCAGCTTTCGCACCTGCCATGGCTCATCTCAGCGTCCTCGGCATCTCCCAAGCAGACCAAGCAAACTTCGTCGATTGTACTAGCGCAGTTCCATCA
GGATCCAATGCGAGAATGATTCGTGCAGCACCCATCAACGACAGAATTAGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCGAAGACTTTCGCTCTCTTTGCCTTCACGGCTCTTGCTGAGGCATCAGGCAGTTGTCCTGCTATCTGGTCGACCGTGGCCTCAGATCTTTCACAATCATTCATCGGCAGCAAC
GGATGTACCGATCTCGCCCGAGGCGCCATCCGTTTCGCCTTCCACGATTCTG
CGTCATATTCTTCCAAAACACAATACTATGCACCTGCTACTGGTGGCGCTGATGGATCGCTCCTCCTG
AGTTCTGTGGAGATCACTCGAGATGAGAACAATGGTCTTCAGTCATACTACGGTTTCCTCCAGGAGAAGTACTCCAAGTACAAGTCTCAAGTCGGTGCTGCAGACTTGGTCCAATTCGCC
GCTAGTGTGGCAATTGTCAGCTGTCCTGGAGGCCCCAAGGTCCCTACG
GTTGTTGGCCGAAAGGATACCAGTACTGCAGCACCGGACAATCTCCTGCCGAAAGCCTTCGGCGCAGGCGCT
GCGCAACAAGTGCTAATCCAACTGTTCGAGGACAAGGGAATCAGTCAACCAGAGCTTGCTGCTTTGATTGGCGCACACACTGCATCAAAGGCTGTGGCTCAAGAGGCCTACGGTGTTCCT
TACAATG
GTCCTCAAGATTCCACACCTGGTCAGTGGGACGTGAAATACTACTCCGACACGGACAATCACCCCAGTGGTGTCTACAGCTTTGAATCAGATGTCAACCTTTCAAACCCCAAC
TCGACTGTAGGCCAGACTTTCCAGAGCTTCGTCAACAGTCAGA
GCAAATGGAATGCAGCTTTCGCACCTGCCATGGCTCATCTCAGCGTCCTCGGCATCTCCCAAGCAGACCAAGCAAAC
TTCGTCGATTGTACTAGCGCAGTTCCATCAGGATCCAATGCGAGAATGATTCGTGCAGCACCCATCAACGACAGAATTAGATGA

Retrieve as FASTA