Entry information : ApulCIIAC02
Entry ID 12370
Creation 2013-06-03 (Nizar Fawal)
Last sequence changes 2017-05-02 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-02 (Catherine Mathe)
Peroxidase information: ApulCIIAC02
Name ApulCIIAC02
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Dothioraceae Aureobasidium
Organism Aureobasidium pullulans    [TaxId: 5580 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApulCIIAC02
start..stop
S start..stop
BdotCIIAC02 376 5e-131 6..346 3..340
ApulCIIAC01 366 2e-127 53..346 18..307
ApruCIIAC01 361 1e-124 53..346 74..362
MgCIIAC01 338 4e-116 46..344 31..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1527213..1527492 280 N° 2 1527544..1528304 761  
join(1527213..1527492,1527544..1528304)


exon

Literature and cross-references ApulCIIAC02
DNA ref. JGI genome:   scaffold_3 (1527213..1528304)
Cluster/Prediction ref. JGI gene:   352727
Protein sequence: ApulCIIAC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (327)
PWM (Da):   %s   36340.17 (34232.0)  
PI (pH):   %s   7.95 (8.30) Peptide Signal:   %s   cut: 20 range:20-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIQNLASLLLVSSLALVDAFSLPEAASSFSSLLASSLNNAIPNTLLIRKDGGSGGCPAIWTSISSDLTSSFLGSDGQCTDLARAAIRFAFHDAGPYSSKTVFYAPAAGGADGSLLLNSDEINRPENGGLADYRTWLMGKYTQYNQKAKVGAADLIQFAGSHAVITCPGGPKIKTVVGRTDTSTIAPDGFLPAGFGPNSSHDILFQLFADKGFSARDLAALIGAHSTSKAFTQQANGIPSGGQQDSTPGKWDIDYYAQVNSPPTGTYRFQSDINLSQANTTVGKQFQGFVGNQGKWTSSFADAMFRLSVLGIPSSSQSGFVDCTNALPRGTSSKRDIRAAPINYRAR*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCAGAACCTTGCTTCTCTGCTGCTGGTGAGCAGCCTCGCCTTGGTGGACGCATTTTCATTGCCAGAAGCAGCCTCCTCATTCTCTTCCTTGCTTGCGTCCTCTTTGAACAACGCT
ATTCCCAACACGCTTCTCATCCGTAAGGACGGTGGCTCTGGCGGATGTCCAGCCATCTGGACCAGCATATCATCTGATCTCACCTCATCTTTCCTGGGATCGGATGGACAATGCACCGAT
CTCGCACGAGCTGCTATTCGATTCGCGTTCCACGATGCTG
GTAAGTAGACTGACCGTGTGTGACGAACCTCATAAACTGACATTTTCGCAGGCCCATACTCTTCGAAAACGGTGTTCTAC
GCTCCTGCTGCAGGTGGTGCTGATGGTTCCCTTCTTCTCAACTCAGACGAGATCAACAGACCTGAGAACGGAGGTCTCGCCGACTACCGAACATGGCTGATGGGAAAGTACACTCAGTAC
AACCAGAAAGCCAAGGTCGGCGCAGCAGACTTGATCCAATTCGCCGGCTCTCACGCCGTCATCACATGTCCCGGTGGCCCCAAGATCAAGACAGTGGTTGGCAGAACAGACACCTCCACC
ATTGCACCTGACGGCTTCCTTCCTGCTGGCTTCGGACCCAACTCCTCTCACGATATCTTGTTCCAGCTCTTTGCCGATAAAGGCTTCAGCGCTAGAGATCTTGCAGCCCTCATCGGCGCC
CACTCCACCAGCAAAGCCTTCACCCAACAAGCCAATGGTATTCCCTCTGGCGGGCAACAAGACTCAACTCCCGGCAAATGGGATATTGACTACTATGCTCAAGTCAACAGCCCACCTACT
GGCACCTACCGCTTCCAATCTGACATCAACCTGTCCCAAGCGAACACCACTGTTGGTAAACAATTCCAGGGCTTTGTCGGCAACCAGGGTAAATGGACCAGCTCGTTTGCTGACGCCATG
TTCCGCTTGAGTGTTTTGGGTATTCCGTCGTCGTCGCAGAGCGGGTTTGTTGATTGCACGAATGCGTTGCCCAGGGGCACCTCTTCGAAGAGAGATATCCGCGCTGCTCCTATCAATTAT
CGCGCGCGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCAGAACCTTGCTTCTCTGCTGCTGGTGAGCAGCCTCGCCTTGGTGGACGCATTTTCATTGCCAGAAGCAGCCTCCTCATTCTCTTCCTTGCTTGCGTCCTCTTTGAACAACGCT
ATTCCCAACACGCTTCTCATCCGTAAGGACGGTGGCTCTGGCGGATGTCCAGCCATCTGGACCAGCATATCATCTGATCTCACCTCATCTTTCCTGGGATCGGATGGACAATGCACCGAT
CTCGCACGAGCTGCTATTCGATTCGCGTTCCACGATGCTG
GCCCATACTCTTCGAAAACGGTGTTCTACGCTCCTGCTGCAGGTGGTGCTGATGGTTCCCTTCTTCTCAACTCAGACGAG
ATCAACAGACCTGAGAACGGAGGTCTCGCCGACTACCGAACATGGCTGATGGGAAAGTACACTCAGTACAACCAGAAAGCCAAGGTCGGCGCAGCAGACTTGATCCAATTCGCCGGCTCT
CACGCCGTCATCACATGTCCCGGTGGCCCCAAGATCAAGACAGTGGTTGGCAGAACAGACACCTCCACCATTGCACCTGACGGCTTCCTTCCTGCTGGCTTCGGACCCAACTCCTCTCAC
GATATCTTGTTCCAGCTCTTTGCCGATAAAGGCTTCAGCGCTAGAGATCTTGCAGCCCTCATCGGCGCCCACTCCACCAGCAAAGCCTTCACCCAACAAGCCAATGGTATTCCCTCTGGC
GGGCAACAAGACTCAACTCCCGGCAAATGGGATATTGACTACTATGCTCAAGTCAACAGCCCACCTACTGGCACCTACCGCTTCCAATCTGACATCAACCTGTCCCAAGCGAACACCACT
GTTGGTAAACAATTCCAGGGCTTTGTCGGCAACCAGGGTAAATGGACCAGCTCGTTTGCTGACGCCATGTTCCGCTTGAGTGTTTTGGGTATTCCGTCGTCGTCGCAGAGCGGGTTTGTT
GATTGCACGAATGCGTTGCCCAGGGGCACCTCTTCGAAGAGAGATATCCGCGCTGCTCCTATCAATTATCGCGCGCGGTGA

Retrieve as FASTA