Entry information : GgrGPx01
Entry ID 12372
Creation 2013-06-03 (Christophe Dunand)
Last sequence changes 2013-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-03 (Christophe Dunand)
Peroxidase information: GgrGPx01
Name GgrGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Gaeumannomyces
Organism Gaeumannomyces graminis    [TaxId: 29850 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GgrGPx01
start..stop
S start..stop
MpoaGPx01 315 1e-112 1..167 1..167
MgrGPx 291 7e-103 1..167 1..167
CgraGPx01 291 9e-102 1..168 69..236
CfioGPx01_MH18 288 2e-100 1..168 74..241
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 283850..283892 43 N° 2 284257..284723 467  
join(283850..283892,284257..284723)


exon

Literature and cross-references GgrGPx01
DNA ref. GenBank:   GL385396.1 (283850..284723)
Protein sequence: GgrGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18813.51  
PI (pH):   %s   5.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASTFYDFKPLNKKGEEAPLSEYKGKVVLVVNTASECGFTPQYGGLETVYKKLKETHGDDFVILGFPCNQFGGQEPGTDEEIQSFCQVNYGVSFPIMGKVDVNGDNASPLWKWLKEEQSGIMGIKSVKWNFEKFLIGRDGKVKRRWASTTKPEAIEKDIVKELEVKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCATCTACCTTTTACGACTTTAAGCCCCTGAACAGTACGTGATCAGCGCCATCTTGCTGGCGCTCCTTGTCGCAGCCCCTCCCCGCTTTCTCCCACGTTCCAATCCCCGCT
GGCCGCCAGACCCCTCCAACTTTCCACCACAGCCACCACTAGGCTATCCAGTCATATGCGCGCCTCCCGTCTTCCAATTATTGTCGGCCCATCAAGTAGTCGTTGCTGCCGTCCCCAAGT
GGGCGACGCCAAGTCGACCTCTATGTTTGGCTATCCTAGACCGAAGCAACCCCACGCATAAATGACGCATATCGCCCTCCTTTCATACCCACCCGAACAGATCTCTGTCAAAGCTGCCAA
GCAGCTTCACCTCGGCCACTGCAAACAATTACTAACCCACTCAACAGAGAAGGGCGAGGAGGCTCCTCTGTCTGAGTACAAGGGCAAAGTGGTCCTCGTGGTGAACACGGCGTCCGAGTG
CGGCTTCACGCCGCAGTACGGCGGTCTAGAGACCGTGTACAAGAAGCTCAAGGAGACGCACGGCGACGACTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGG
CACCGACGAGGAGATCCAGTCCTTCTGCCAGGTCAACTACGGCGTCAGCTTCCCCATCATGGGCAAGGTGGACGTCAACGGCGACAATGCGAGCCCGCTGTGGAAGTGGCTCAAGGAGGA
GCAGTCGGGCATCATGGGCATCAAGTCGGTCAAGTGGAACTTTGAGAAGTTTCTCATCGGCCGCGACGGGAAAGTCAAGCGCCGGTGGGCCAGCACCACCAAGCCCGAGGCTATCGAGAA
GGATATCGTCAAGGAGCTCGAGGTCAAGGCTTAG

Retrieve as FASTA