Entry information : ManiCcP01
Entry ID 12388
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2013-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-06 (Christophe Dunand)
Peroxidase information: ManiCcP01
Name ManiCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Clavicipitaceae Metarhizium
Organism Metarhizium anisopliae    [TaxId: 5530 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ManiCcP01
start..stop
S start..stop
MacrCcP01 700 0 1..364 1..364
EfeCcP_F11 650 0 1..364 1..365
NhaeCcP01 614 0 1..361 1..356
GzCcP02 601 0 1..362 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230504..230996 493 N° 2 230029..230402 374 N° 3 229731..229958 228  
complement(join(229731..229958,230029..230402,230504..230996))


exon

Literature and cross-references ManiCcP01
Protein ref. GenBank:   EFY97250.1
DNA ref. GenBank:   GL698723.1 (230996..229731)
Protein sequence: ManiCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   40703.99  
PI (pH):   %s   8.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATRQFARVATRTATRNAFAVAPRQAFRQQGRRWYSSEPAPQKGSSTWLYLTGAAAAGGLGFWYYTASGSPSAASSKIVNPTKEDYQKVYDEIASRLEEKDDYDDGSFGPVLLRLAWHASGTFDKETGTGGSNGATMRFAPESDHGANAGLVAARNFLEPVKAKFPWITHSDLWILGGVCAVQEMQGPYIPYRPGRSDRDVSACTPDGRLPDATQGSDHLRNIFYRMGFNDQEIVALSGAHALGRCHTDRSGFSGPWTFSPTILTNDYYRLLVEEKWQWKKWNGPKYEDKTTQTLMMLPTDMVLVQDKKFKPWTEKYAKDNDLFFKDFSAVVTKLFELGVPFAEGTENQRWNMKPTWDESK*

Retrieve as FASTA  
Remarks complete sequence from genomic (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCTACTCGTCAATTTGCCCGCGTGGCAACCCGAACCGCTACCCGTAACGCCTTTGCCGTCGCTCCTCGCCAGGCTTTTCGCCAGCAGGGTCGCCGATGGTACTCCTCTGAG
CCTGCTCCTCAGAAGGGGTCTTCCACCTGGTTGTACCTGACTGGTGCTGCCGCCGCGGGTGGTCTCGGATTCTGGTACTACACTGCTTCTGGCTCCCCTTCCGCCGCCTCCAGCAAAATC
GTCAATCCCACCAAGGAGGACTACCAGAAGGTCTATGACGAGATTGCCAGCCGCCTCGAAGAAAAGGACGACTATGATGACGGTAGCTTCGGTCCTGTGCTGCTCCGTCTCGCTTGGCAC
GCCAGCGGTACATTTGATAAGGAAACCGGCACTGGTGGTAGCAACGGTGCCACTATGCGCTTTGCCCCCGAGTCTGACCACGGTGCCAATGCTGGTCTGGTTGCTGCTCGCAACTTCCTA
GAGCCTGTCAAGG
GTAAGCAAATCAACATGTTTTGCATCAACCCAGTCTCTGAGGAGCTGGTTCAGTGTGACTCTGAATCCATGACTAGAATTTGGGCTGACCTCTTTCTCTAGCCAAAT
TCCCCTGGATAACCCACTCTGATCTCTGGATCCTCGGCGGTGTCTGCGCCGTCCAGGAGATGCAGGGCCCCTACATCCCCTACCGCCCTGGCCGTTCTGACCGTGATGTCTCTGCCTGCA
CTCCTGACGGTCGTCTCCCCGATGCCACCCAGGGCTCCGACCACCTCCGCAACATTTTCTACCGTATGGGCTTCAACGACCAAGAGATCGTTGCCCTCTCTGGCGCCCACGCCCTCGGCC
GCTGCCACACTGACCGCTCTGGATTCTCTGGTCCCTGGACTTTCTCTCCCACCATCCTGACCAACGATTACTACCGTCTGCTAGTTGAGGAGAAGTGGCAGTGGAAGAAGTGGAACGGGC
CCAAGCAG
GTATGTAGCCGAGATTTGGTCTCTTTCGGGGTTTCCCCTCTTGAAGCACTTGCTGACTTGTTCGCTGCAGTACGAGGACAAGACCACCCAGACCCTCATGATGCTTCCCACC
GACATGGTCCTCGTCCAGGACAAGAAGTTCAAGCCCTGGACCGAAAAGTATGCCAAGGACAACGACTTGTTCTTCAAGGACTTCTCCGCCGTTGTTACCAAGCTGTTTGAGCTGGGTGTT
CCTTTTGCCGAGGGCACCGAGAACCAGCGATGGAACATGAAGCCCACTTGGGACGAGTCCAAATAA

Retrieve as FASTA