Entry information : GdesGPx01
Entry ID 12409
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2013-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-04 (Christophe Dunand)
Peroxidase information: GdesGPx01
Name GdesGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Myxotrichaceae Geomyces
Organism Geomyces destructans (Pseudogymnoascus destructans)    [TaxId: 655981 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GdesGPx01
start..stop
S start..stop
MgrGPx 270 4e-93 82..246 1..165
MvarGPx01 269 2e-91 59..246 57..244
CgraGPx01 268 4e-91 1..249 1..236
DescGPx01 268 6e-91 30..250 36..257
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 142673..142958 286 N° 2 142041..142531 491  
complement(join(142041..142531,142673..142958))


exon

Literature and cross-references GdesGPx01
DNA ref. GenBank:   GL573206.1 (142958..142041)
Protein sequence: GdesGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   258
PWM (Da):   %s   28700.64  
PI (pH):   %s   10.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRQFRPNLQPASFVRSYGGGTSRGPQSRLPSLYKCRRARMRGDNSRHQASLFTASYNPITALYPTNTQSHIHSRKRNISNMASATSVFDFKPLNKKGEPTPLSAYAGKVLLIVNTASKCGFTPQYGGLEALYQKIEASHPGEFVVLGFPCNQFGGQEPAADDKIQEFCQINYGVTFPIFGKTEVNGDNANPLWEYMKSEKPGLMGMKRVKWNFEKFLISREGKVVERWASTKKPETLEGDVLKEIAKKAAEPVKSEL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGCGACAGTTCAGGCCCAATCTACAGCCGGCCAGCTTTGTAAGAAGTTATGGTGGAGGGACGAGCCGCGGTCCACAGTCTCGCTTGCCATCTTTATATAAATGCCGACGGGCCCGC
ATGAGGGGTGACAACTCCCGCCACCAAGCATCTTTATTCACTGCTAGCTACAACCCTATTACTGCTTTATATCCTACAAATACCCAATCGCATATACATAGTCGTAAAAGAAACATATCA
AACATGGCGTCAGCTACCTCCGTCTTCGACTTCAAGCCGCTCAACA
GTAAGTCGCATCCTTCACATGTCTGCTTTGCGCCAGCGACAACACCAATTTTCCCCCATATCGCATTACCCAGG
CGTCCCTATCATCATATTTACCGCGCGCTGCCACTTCCGTCATACAATCGTCGCTAACCCCCAACAGAGAAGGGCGAACCCACACCCCTCTCTGCCTACGCCGGCAAAGTCCTCCTCATC
GTCAACACCGCCTCCAAGTGCGGCTTCACCCCCCAATACGGCGGCCTCGAAGCCCTCTACCAGAAGATCGAAGCGTCGCACCCCGGCGAGTTCGTCGTCCTCGGCTTCCCCTGCAACCAA
TTCGGCGGCCAGGAGCCCGCAGCCGACGACAAGATCCAGGAGTTCTGCCAGATCAACTACGGCGTTACATTCCCTATCTTCGGAAAGACTGAGGTCAATGGCGATAATGCCAATCCGCTG
TGGGAGTACATGAAGAGCGAGAAGCCGGGGTTGATGGGCATGAAGCGCGTGAAGTGGAACTTTGAGAAGTTCCTGATTAGCAGGGAGGGGAAGGTTGTCGAGAGGTGGGCAAGCACGAAG
AAGCCCGAGACTTTGGAGGGTGATGTTCTCAAGGAGATTGCGAAGAAGGCGGCTGAGCCAGTGAAGTCGGAGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGCGACAGTTCAGGCCCAATCTACAGCCGGCCAGCTTTGTAAGAAGTTATGGTGGAGGGACGAGCCGCGGTCCACAGTCTCGCTTGCCATCTTTATATAAATGCCGACGGGCCCGC
ATGAGGGGTGACAACTCCCGCCACCAAGCATCTTTATTCACTGCTAGCTACAACCCTATTACTGCTTTATATCCTACAAATACCCAATCGCATATACATAGTCGTAAAAGAAACATATCA
AACATGGCGTCAGCTACCTCCGTCTTCGACTTCAAGCCGCTCAACA
AGAAGGGCGAACCCACACCCCTCTCTGCCTACGCCGGCAAAGTCCTCCTCATCGTCAACACCGCCTCCAAGTGC
GGCTTCACCCCCCAATACGGCGGCCTCGAAGCCCTCTACCAGAAGATCGAAGCGTCGCACCCCGGCGAGTTCGTCGTCCTCGGCTTCCCCTGCAACCAATTCGGCGGCCAGGAGCCCGCA
GCCGACGACAAGATCCAGGAGTTCTGCCAGATCAACTACGGCGTTACATTCCCTATCTTCGGAAAGACTGAGGTCAATGGCGATAATGCCAATCCGCTGTGGGAGTACATGAAGAGCGAG
AAGCCGGGGTTGATGGGCATGAAGCGCGTGAAGTGGAACTTTGAGAAGTTCCTGATTAGCAGGGAGGGGAAGGTTGTCGAGAGGTGGGCAAGCACGAAGAAGCCCGAGACTTTGGAGGGT
GATGTTCTCAAGGAGATTGCGAAGAAGGCGGCTGAGCCAGTGAAGTCGGAGCTGTAA

Retrieve as FASTA