Entry information : SverGPx01
Entry ID 12417
Creation 2013-06-04 (Christophe Dunand)
Last sequence changes 2013-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: SverGPx01
Name SverGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sebacinaceae Sebacina
Organism Sebacina vermifera    [TaxId: 109899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SverGPx01
start..stop
S start..stop
PindGPx01 284 2e-99 1..160 1..160
DsGPx01 270 6e-93 3..160 81..237
PoGPx01_PC15 269 1e-92 1..160 82..240
PstrGPx01 270 1e-92 3..160 98..254
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183394..183417 24 N° 2 183250..183335 86 N° 3 182968..183186 219 N° 4 182848..182893 46
N° 5 182586..182795 210  
complement(join(182586..182795,182848..182893,182968..183186,183250..183335,1833 94..183417))


exon

Literature and cross-references SverGPx01
DNA ref. JGI genome:   scaffold_22 (183417..182586)
Cluster/Prediction ref. JGI gene:   329973
Protein sequence: SverGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   20974.61  
PI (pH):   %s   5.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTGFYDLKMSLPGGKGVYTFDQLKGKVVLIVNVASQCGFTPQYKGLEGLNKKYADQGLVVLGFPSNQFGGQEPGTDEEIASFCELNHGVTFPLMKKSDVNGNDTNEVYQWLKKEKAGLLGMTRIWNFEKFLIDQNGKVVHRWASTTTPATIDAEVAKLLANNPAPAPTSTTTAEPPVPEATAASGSEAKDTAAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCGGATTCTATGATCTCAAGGTAAAGTCCACCTCACTCGACGTTCGGCGCGGCTTTGTAAAACTCACCGGCCCATTAGATGTCCTTGCCTGGCGGCAAAGGCGTATACACATTTGA
CCAACTGAAAGGAAAGGTCGTGCTTATCGTCAACGTTGCCTCGCAATG
GTAAGCTCATGGTTATTTTTGGCACATTCTTTTCTCCTTCTAATTTCTTTGCGTCTTCTCTAGTGGATTCAC
ACCACAGTATAAAGGTCTCGAGGGACTGAACAAGAAATACGCCGACCAAGGGTTGGTCGTTCTTGGATTTCCCTCAAACCAGTTTGGTGGACAAGAACCCGGAACAGACGAGGAGATTGC
GAGCTTTTGCGAGTTGAACCACGGCGTCACGTTTCCCCTTATGAAGAAGAGTGATGTGAATGGGAATGACACAAACGAGGTGTACCAGTG
GTAAGTGGGCGCCCGTGTGGCGTGGCCTGG
TCTATATGCTTGACTTTCATACTTGTACTGATGACACTTTATAGGTTGAAGAAGGAAAAGGCAGGGCTTTTGGGAATGACACGCATCAAGGCAGGTGTCCATAGCCAGGCCTCCACTTTC
TTTCTATTAACACATTTTACAGTGGAACTTTGAAAAGTTTTTGATCGACCAGAACGGCAAGGTTGTGCATAGATGGGCATCGACCACGACGCCCGCCACTATTGACGCCGAGGTGGCAAA
GTTGCTCGCCAATAACCCCGCGCCAGCTCCTACGAGCACAACCACTGCAGAACCACCTGTTCCAGAGGCTACTGCTGCCTCAGGGTCGGAAGCGAAGGATACTGCAGCGCTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCGGATTCTATGATCTCAAGATGTCCTTGCCTGGCGGCAAAGGCGTATACACATTTGACCAACTGAAAGGAAAGGTCGTGCTTATCGTCAACGTTGCCTCGCAATGTGGATTCACA
CCACAGTATAAAGGTCTCGAGGGACTGAACAAGAAATACGCCGACCAAGGGTTGGTCGTTCTTGGATTTCCCTCAAACCAGTTTGGTGGACAAGAACCCGGAACAGACGAGGAGATTGCG
AGCTTTTGCGAGTTGAACCACGGCGTCACGTTTCCCCTTATGAAGAAGAGTGATGTGAATGGGAATGACACAAACGAGGTGTACCAGTG
GTTGAAGAAGGAAAAGGCAGGGCTTTTGGGA
ATGACACGCATCAAG
TGGAACTTTGAAAAGTTTTTGATCGACCAGAACGGCAAGGTTGTGCATAGATGGGCATCGACCACGACGCCCGCCACTATTGACGCCGAGGTGGCAAAGTTGCTC
GCCAATAACCCCGCGCCAGCTCCTACGAGCACAACCACTGCAGAACCACCTGTTCCAGAGGCTACTGCTGCCTCAGGGTCGGAAGCGAAGGATACTGCAGCGCTT

Retrieve as FASTA