Entry information : VaaGPx01
Entry ID 12419
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2016-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-20 (Achraf Jemmat)
Peroxidase information: VaaGPx01
Name VaaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Verticillium
Organism Verticillium albo-atrum    [TaxId: 27335 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VaaGPx01
start..stop
S start..stop
VdaGPx01 466 1e-169 1..235 1..236
CfioGPx01_MH18 325 9e-114 31..237 36..240
CgraGPx01 323 3e-113 43..235 23..233
ChigGPx01 321 2e-112 65..237 67..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 632866..633118 253 N° 2 633177..633676 500  
join(632866..633118,633177..633676)


exon

Literature and cross-references VaaGPx01
Protein ref. GenBank:   EEY14107.1
DNA ref. GenBank:   DS985214.1 (632866..633676)
Protein sequence: VaaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27983.33  
PI (pH):   %s   9.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTCPRFVSQHFRQLAYRPRLDHKSTDTLARLKTCSLQKQQPYHIQHRRPTNTSVTLRYTPPSDSIRTRTTMASATSFYDFKPLDKRGQETPTADYKGKVVLIVNTASKCGFTPQFEGLEKLYKSIKEKHGDDFVILGFPCNQFAGQDPGTDDDIQSFCQLNYGVTFPIMAKSDVNGDAANPLFTWLKDEKPGIMGLKRIKWNFEKFLVGRDGKVKGRWASTTKPEALEKPVLDELAKPAPADAAPAAKPE

Retrieve as FASTA  
Remarks Complete sequence from genomic. Strain="VaMs.102".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATGTCCTCGGTTCGTGTCGCAGCATTTTCGCCAGCTCGCATACAGACCCCGCCTTGACCACAAATCTACTGACACCCTCGCTCGTTTGAAAACTTGCTCCCTACAAAAACAACAA
CCGTACCACATACAACACCGTCGCCCGACAAACACATCCGTGACCTTGAGATACACCCCGCCTTCCGACTCGATACGAACACGAACAACCATGGCATCCGCTACAAGCTTCTACGACTTC
AAGCCGCTTGACA
GTACGTGTCTGGCCCCCATGCGCGCTCCAATTGGACTGTCCGCTAACACATTGATCAGAGCGCGGCCAGGAGACCCCCACTGCCGATTACAAGGGCAAGGTCGTCCT
CATCGTCAACACGGCCTCCAAGTGCGGTTTCACACCGCAATTCGAGGGCCTCGAGAAGCTCTACAAGTCCATCAAGGAGAAGCACGGTGATGACTTTGTCATCCTCGGCTTCCCCTGCAA
CCAGTTCGCCGGCCAGGACCCCGGTACCGACGACGACATCCAGAGCTTCTGCCAGCTCAACTACGGTGTCACCTTCCCCATTATGGCCAAGTCCGACGTCAACGGCGATGCGGCCAACCC
CCTCTTCACCTGGCTCAAGGATGAGAAGCCCGGTATCATGGGCCTCAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTTGTCGGCCGCGACGGCAAGGTCAAGGGACGCTGGGCCAGCAC
CACCAAGCCCGAAGCTCTTGAGAAGCCCGTGCTCGATGAGCTCGCCAAGCCCGCGCCCGCCGATGCTGCTCCTGCTGCCAAGCCCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATGTCCTCGGTTCGTGTCGCAGCATTTTCGCCAGCTCGCATACAGACCCCGCCTTGACCACAAATCTACTGACACCCTCGCTCGTTTGAAAACTTGCTCCCTACAAAAACAACAA
CCGTACCACATACAACACCGTCGCCCGACAAACACATCCGTGACCTTGAGATACACCCCGCCTTCCGACTCGATACGAACACGAACAACCATGGCATCCGCTACAAGCTTCTACGACTTC
AAGCCGCTTGACA
AGCGCGGCCAGGAGACCCCCACTGCCGATTACAAGGGCAAGGTCGTCCTCATCGTCAACACGGCCTCCAAGTGCGGTTTCACACCGCAATTCGAGGGCCTCGAGAAG
CTCTACAAGTCCATCAAGGAGAAGCACGGTGATGACTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGCCGGCCAGGACCCCGGTACCGACGACGACATCCAGAGCTTCTGCCAGCTC
AACTACGGTGTCACCTTCCCCATTATGGCCAAGTCCGACGTCAACGGCGATGCGGCCAACCCCCTCTTCACCTGGCTCAAGGATGAGAAGCCCGGTATCATGGGCCTCAAGCGCATCAAG
TGGAACTTTGAGAAGTTCCTTGTCGGCCGCGACGGCAAGGTCAAGGGACGCTGGGCCAGCACCACCAAGCCCGAAGCTCTTGAGAAGCCCGTGCTCGATGAGCTCGCCAAGCCCGCGCCC
GCCGATGCTGCTCCTGCTGCCAAGCCCGAGTAA

Retrieve as FASTA