Entry information : AimmGPx01
Entry ID 12420
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2013-06-04 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: AimmGPx01
Name AimmGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Ascobolaceae Ascobolus
Organism Ascobolus immersus    [TaxId: 5191 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AimmGPx01
start..stop
S start..stop
MfiGPx01 228 7e-77 8..166 59..219
MbicuGPx02 223 4e-76 7..164 1..158
AoliGPx01 224 4e-76 1..170 1..170
PrubGPx01 225 6e-76 2..165 55..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1249758..1249876 119 N° 2 1249556..1249699 144 N° 3 1249250..1249502 253  
complement(join(1249250..1249502,1249556..1249699,1249758..1249876))


exon

Literature and cross-references AimmGPx01
DNA ref. JGI genome:   scaffold_1 (1249876..1249250)
Cluster/Prediction ref. JGI gene:   368058
Protein sequence: AimmGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   18820.64  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASVPQSFYDLVAKDAKGQDFKFSDLKGKPVLIVNVASKCGFTGQYAGLQQLHEKYGSKGLQILGFPCNQFGGQEPGEDSDIQSFCSLNYGVSFPVLGKVEVNGDNASPVWEFLKNKKSGLLGLKRIKWNFEKFLVSKDGEVVERWASTSTPASLESAIEKELAKLNKSE

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTTCAGTTCCACAATCGTTCTACGACCTCGTCGCAAAGGATGCGAAGGGACAGGATTTCAAATTCTCCGACCTCAAGGGCAAGCCAGTCTTGATTGTCAACGTTGCTTCCAAG
TAGGTTCTATTTGGTGGGGGTGGGTCTGCGGGGTAGGCGAAACTAACGTTAAGACAGGTGCGGCTTCACCGGTCAATACGCTGGGCTTCAACAACTCCATGAGAAGTACGGTTCAAAGGG
TCTTCAGATCCTCGGTTTCCCATGCAACCAGTTCGGTGGACAAGAGCCTGGTGAGGACTCGGACATCCAGTCGTTCTGCTC
GTGAGTCTGCCAATTGCTTTGGGTCATTTCTTGTCGCTA
ACATTGCACTCCAGCTTGAACTATGGCGTTTCATTCCCCGTCCTCGGAAAGGTTGAAGTCAACGGAGATAATGCCTCACCAGTTTGGGAGTTCTTGAAGAACAAGAAGTCTGGCTTATTG
GGCCTTAAGAGGATAAAGTGGAACTTTGAGAAGTTTTTGGTGAGCAAGGATGGTGAGGTTGTTGAGAGATGGGCTAGCACTTCAACCCCGGCCAGCCTCGAGTCTGCCATCGAGAAAGAG
TTGGCAAAGCTGAACAAGTCGGAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTTCAGTTCCACAATCGTTCTACGACCTCGTCGCAAAGGATGCGAAGGGACAGGATTTCAAATTCTCCGACCTCAAGGGCAAGCCAGTCTTGATTGTCAACGTTGCTTCCAAG
TGCGGCTTCACCGGTCAATACGCTGGGCTTCAACAACTCCATGAGAAGTACGGTTCAAAGGGTCTTCAGATCCTCGGTTTCCCATGCAACCAGTTCGGTGGACAAGAGCCTGGTGAGGAC
TCGGACATCCAGTCGTTCTGCTC
CTTGAACTATGGCGTTTCATTCCCCGTCCTCGGAAAGGTTGAAGTCAACGGAGATAATGCCTCACCAGTTTGGGAGTTCTTGAAGAACAAGAAGTCT
GGCTTATTGGGCCTTAAGAGGATAAAGTGGAACTTTGAGAAGTTTTTGGTGAGCAAGGATGGTGAGGTTGTTGAGAGATGGGCTAGCACTTCAACCCCGGCCAGCCTCGAGTCTGCCATC
GAGAAAGAGTTGGCAAAGCTGAACAAGTCGGAATTG

Retrieve as FASTA