Entry information : MicaGPx01
Entry ID 12436
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-17 (Achraf Jemmat)
Peroxidase information: MicaGPx01
Name MicaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Arthrodermataceae Arthroderma
Organism Microsporum canis (Arthroderma otae)     [TaxId: 63405 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MicaGPx01
start..stop
S start..stop
TrubrGPx01 337 1e-120 1..174 1..174
AbenGPx01 336 2e-120 1..174 1..174
AgyGPx01 335 4e-120 1..174 1..174
TverGPx01 335 5e-120 1..174 1..174
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 478263..478305 43 N° 2 477699..478180 482  
complement(join(477699..478180,478263..478305))


exon

Literature and cross-references MicaGPx01
Protein ref. GenBank:   EEQ30192.1
DNA ref. GenBank:   DS995703.1 (478305..477699)
Protein sequence: MicaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   18955.59  
PI (pH):   %s   8.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATSFYDFEPVDKKGQPFPLTSLQGKVVLVVNTASKCGFTPQFAGLEELYKSISSSHPDKFTILGFPCNQFGSQDPGSNDEIQTFCQANYGVTFPVLGKIDVNGDNTAPVYNWLKKEMPGIMGLKRIKWNFEKFLVDANGKVVGRWASTTKPESLKSTILAEIEKAGKASQL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCAGCTACATCCTTTTACGACTTTGAGCCGGTTGACAGTATGCAATAATCATCTCCCCTTTGTTGCGCTATTATTACTATAATCATTAACAACTGCGCGACTTTTTTTACAAAA
AACAGAGAAAGGACAGCCCTTCCCTCTCACCTCGCTCCAGGGCAAAGTCGTCCTGGTCGTCAACACGGCATCAAAATGCGGTTTCACCCCGCAGTTCGCCGGTCTCGAGGAGCTCTACAA
GTCAATCAGCTCCTCGCACCCGGATAAGTTCACCATACTAGGCTTCCCGTGCAACCAGTTCGGTTCTCAGGACCCCGGAAGCAACGATGAGATTCAGACATTCTGCCAGGCCAACTACGG
CGTCACATTCCCGGTTCTCGGCAAGATAGATGTCAACGGTGACAACACTGCGCCAGTATACAACTGGCTGAAGAAGGAGATGCCTGGCATCATGGGTCTGAAGAGAATTAAATGGAACTT
TGAGAAGTTCTTGGTCGACGCCAATGGAAAGGTCGTTGGGCGATGGGCGAGCACCACGAAACCCGAGTCTCTCAAGAGCACCATCCTGGCTGAGATTGAGAAAGCTGGAAAGGCCTCTCA
GCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCAGCTACATCCTTTTACGACTTTGAGCCGGTTGACAAGAAAGGACAGCCCTTCCCTCTCACCTCGCTCCAGGGCAAAGTCGTCCTGGTCGTCAACACGGCATCAAAATGCGGT
TTCACCCCGCAGTTCGCCGGTCTCGAGGAGCTCTACAAGTCAATCAGCTCCTCGCACCCGGATAAGTTCACCATACTAGGCTTCCCGTGCAACCAGTTCGGTTCTCAGGACCCCGGAAGC
AACGATGAGATTCAGACATTCTGCCAGGCCAACTACGGCGTCACATTCCCGGTTCTCGGCAAGATAGATGTCAACGGTGACAACACTGCGCCAGTATACAACTGGCTGAAGAAGGAGATG
CCTGGCATCATGGGTCTGAAGAGAATTAAATGGAACTTTGAGAAGTTCTTGGTCGACGCCAATGGAAAGGTCGTTGGGCGATGGGCGAGCACCACGAAACCCGAGTCTCTCAAGAGCACC
ATCCTGGCTGAGATTGAGAAAGCTGGAAAGGCCTCTCAGCTGTAG

Retrieve as FASTA