Entry information : AmaGPx02 (AMAG_14623)
Entry ID 12474
Creation 2013-06-06 (Christophe Dunand)
Last sequence changes 2013-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-06 (Christophe Dunand)
Peroxidase information: AmaGPx02 (AMAG_14623)
Name (synonym) AmaGPx02 (AMAG_14623)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Blastocladiaceae Allomyces
Organism Allomyces macrogynus    [TaxId: 28583 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmaGPx02
start..stop
S start..stop
AmaGPx01 333 1e-119 1..161 1..161
AmaGPx03 274 1e-95 3..161 48..205
AmaGPx04 273 3e-95 3..161 48..205
CangGPx01 270 5e-94 5..161 70..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94879..95014 136 N° 2 94692..94809 118 N° 3 94498..94620 123 N° 4 94323..94432 110
complement(join(94323..94432,94498..94620,94692..94809,94879..95014))


exon

Literature and cross-references AmaGPx02 (AMAG_14623)
Cluster/Prediction ref. Broad:   S7000007216983528
Protein sequence: AmaGPx02 (AMAG_14623)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   18172.25  
PI (pH):   %s   6.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHAPDFYSLSSLDAKKNEVSFEQFKGKVVLIVNVASKCGFTPQYDGLEKLYQTHKDQGLVILGFPSNQFGSQEPGTEEEITSFCRLNYGVTFPIMAKTDVNGDHEHPVYHWLKSQKSGLLGLTRIRWNFEKFLINKEGQVVHRYSSLTKPEDIEKDIVALL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGCACCAGACTTCTACTCGCTCTCGTCGCTCGACGCCAAGAAGAACGAGGTTTCGTTCGAGCAGTTCAAGGGCAAGGTCGTGCTCATCGTCAACGTCGCCAGCAAGTGCGGCTTC
ACGCCCCAGTACGAT
GGTGCGTGTGCATGGTCTGCTGCCTCGTCAACCGCACCAGACCGTCGCTGACCACCACCGATGCGTTCAGGCCTCGAGAAGCTCTACCAGACGCACAAGGACCAG
GGTCTCGTGATTCTCGGCTTCCCGTCGAACCAGTTTGGCTCGCAGGAGCCCGGCACCGAGGAGGAGATCACGAGCTTCTGTC
GGTAAGTACCGACGCGCTGCCGCTCCGCCGTCGCACTT
CTTCTTCTGACGCACACGTTCCCCGAACGACCAGCCTGAACTACGGCGTCACGTTCCCGATCATGGCCAAGACCGACGTCAACGGCGACCACGAGCACCCCGTCTACCACTGGCTCAAGA
GCCAGAAGTCGGGTCTGCTTGGTCTGACGCGCATCA
AGTACGTGCGAATCGCGCCTGATCACCACAATCGCCTCGTTCTCACTCGGTTTTTGTGCGGTCTAGGTGGAACTTTGAAAAGTT
CCTCATCAACAAGGAGGGCCAGGTCGTGCACCGCTACTCGTCGCTCACCAAGCCCGAGGATATCGAGAAGGACATTGTCGCTCTGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGCACCAGACTTCTACTCGCTCTCGTCGCTCGACGCCAAGAAGAACGAGGTTTCGTTCGAGCAGTTCAAGGGCAAGGTCGTGCTCATCGTCAACGTCGCCAGCAAGTGCGGCTTC
ACGCCCCAGTACGAT
GGCCTCGAGAAGCTCTACCAGACGCACAAGGACCAGGGTCTCGTGATTCTCGGCTTCCCGTCGAACCAGTTTGGCTCGCAGGAGCCCGGCACCGAGGAGGAGATC
ACGAGCTTCTGTC
GCCTGAACTACGGCGTCACGTTCCCGATCATGGCCAAGACCGACGTCAACGGCGACCACGAGCACCCCGTCTACCACTGGCTCAAGAGCCAGAAGTCGGGTCTGCTT
GGTCTGACGCGCATCA
GGTGGAACTTTGAAAAGTTCCTCATCAACAAGGAGGGCCAGGTCGTGCACCGCTACTCGTCGCTCACCAAGCCCGAGGATATCGAGAAGGACATTGTCGCTCTG
CTGTAA

Retrieve as FASTA