Entry information : SsGPx04_AU1
Entry ID 12578
Creation 2013-11-12 (Qiang Li)
Last sequence changes 2014-03-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-03 (Christophe Dunand)
Peroxidase information: SsGPx04_AU1
Name SsGPx04_AU1
Class Plant glutathione peroxidase    [Orthogroup: Gpx2004]
Taxonomy Eukaryota Viridiplantae Streptophyta Zygnemophyceae Zygnemataceae Spirogyra
Organism Spirogyra sp    [TaxId: 3181 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsGPx04_AU1
start..stop
S start..stop
SpraGPx04 313 2e-110 19..207 23..207
CbraGPx03 174 1e-54 27..200 63..235
MviGPx 158 4e-49 28..187 32..190
McGPx01 147 2e-44 20..200 78..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..192 192 N° 2 1393..1500 108 N° 3 1880..2089 210 N° 4 2437..2553 117
join(1..192,1393..1500,1880..2089,2437..2553)


exon

Literature and cross-references SsGPx04_AU1
Literature Looking for Ancestral Class III Peroxidases in Green Lineage
Protein sequence: SsGPx04_AU1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (187)
PWM (Da):   %s   22915.05 (20661.9)  
PI (pH):   %s   4.95 (4.93) Peptide Signal:   %s   cut: 22 range:22-208
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMMLSSFFLALALRAPLDCAATDVEGFYAISAMDIDGNYVSLSKYSGTVSLVVNVASKCGLTKSNYEQLSQLQNRFGPRGFQVLAFPCNQFNSQEPGMFRSSNEEVKRFAIQSGANYPLFAKLTVNEPMCKDGGLEDCSSSSSQCCSANNSIYTYLKSAFKGDIDWNFAKFLIGRDGQVLQRYRAQTYPLSIANDIEMALDKDYPFTV*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Sequenced by EEP in LRSV.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGCTGAGTTCCTTCTTCCTCGCCCTCGCCCTGCGGGCCCCGCTCGACTGCGCTGCCACCGATGTCGAAGGATTCTACGCCATTTCCGCGATGGACATTGACGGAAACTATGTG
TCGCTCTCCAAGTACAGCGGCACGGTGTCCCTGGTGGTGAATGTGGCGAGCAAATGCGGGCTTACGAAATCG
GTATTGTTTTCGTTTTGTGTTGTTNGCGACAGCACAGTGCATCCTTGT
ACTCCACAGAAGATGATGATGCTGAGTTCCTTCTTCCTCGTCCTCCTGGTTATTATCCTTATTCATCACATGCCTCCGAGGACTTCTCCCCAGTTCGGGCGCCCACGCTGTTCGTGTTCT
CTCTCGAGGAGTTAACTACATCGGATTGATATTCCTTGAGTTGGTGTTTGAGCTCTTCGAATGCCCTTTTCAAAGCCAAAGACTCTGCTTCAGTTTTTTTCGCCTTTTCGATGGCCTCTT
TGGCTTTCTTGGTCAAGGACGCGTTTTCCACTCGCAATTGGGTCGCCTGAAAAAGGGTAAAACCAGAGAGTGAGAGAGACAGACAGACAGGTAGGAATAGACAGTGAAAATCATAGAAAG
AAAGAATTAGCAAGGAATGAAGGGAAAGGTTTAATGAAAGGTTTTCGGGAAATAGTGGTTTTCGGGAAAGACGACCCAAAGACTTGAGAAAAAGACNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGTTGTTGTCGTTTCAATCTCGACCTTCTGGCTGAATCCCGGTTCGATTTCATCCTGAAATTCAAGAATGCATGAATTGTA
GGTAAGTAATGCAGCAATTCAAGTTGATAAATAAAAGACATTGAGAAATTGTGTTGTGGCCCTCGTCCCAACACATGGTGATCTGTGATAGATCATTGCATCTATTGTGGGAAGAGAGTG
CATAACTGGGAGAAAATGAGCCCAATCGAAATCGGAATCGATACAGAAAAAATCCACAACAACTCAATTGCCATCATTTGTACATTTCAGAGAAACATGCAGCAGCGCACAGCGGATTCG
TTAAGTGGCAACCGGAAAGGAAACTGTCAACCCAGTTTGTAAATCATTGAGAACCATCACTGAAGGGGATGTGCGAAGGTCAGGGTGATTACCTCCTGAGTTTCTTTCCCCGCTCATCAT
TCTTCAAATCTCCATCGGCTNTTTTTTTTTTGTTTTGACGTTCTCATGTTTTTCCGTGTGTGTGTGTGTGTGTTTTTTCTGTCTCCGAGGATTTGCATCCATCATTTATCTCGGAAATTT
GCTCCTCAAATTTTTCACCCGAGATTGACCATCCCCTTTTTTTCCATCTTGTTTTGAACCCGCCCTGTTTAGAATTACGAACAACTATCTCAACTCCAAAATAGATTTGGCCCTCGTGGA
TTCCAAGTTCTGGCTTTCCCTTGCAATCAATTCAACTCTCAAGAGCCTGGTATGTTTAGA
GTACACGTTATAAAATAAGAATGGTCGCATCATTAAAACTATCCATGCAAAGCGATTGAA
TTTGTTAAAAACGCATTCGTCTCGGCCCAATCAAAGTTCCACTTCGAAACTACAAACTAGAAAGCTGTCATGACAACTAGAATCATACAAACGGTTATCTTAGTGCAATAAAATGCACAC
ACAATGGTTGTTAACATTTTTAGCATCCATACAAAAATTTGTATCCTGAAATCCAGAGAATTGCAATCATCAAAATTGGGAACAAAAACAACGAATGTGATGAATTCATACGTTATACAT
GTTGTATCGTGTTTCATATTCATTTCGAATCACTGTTCTCATCATTATTTTTCTTGCATTCTTCAATTTATGTGTCAAGAGCTCAAACGAGGAAGTGAAGCGCTTTGCAATTCAAAGCGG
TGCAAACTATCCCCTTTTTGCAAAATTGACTGTGAATGAACCCATGTGCAAGGATGGAGGGTTAGAGGATTGTTCTTCCTCATCCTCCCAATGCTGCTCCGCCAACAACAGTATCTACAC
TTACCTCAAATCCGCATTCAAGGGCGACATCGATTGGAACTTCGCCAAA
GTACTTATCGATTTTTTTGTTTTGTTTTATCATCGAATATTTTTATGCTGACTCCTTTTTACCTGCTCATT
CTTCTATCTATTTCACAACTTGTGACTTGTACATCGTTTGATTCATTCACCCTAAATCACATCCAGTCCGCATTTTATCAACCATCTTTCACTGAGTTAGTCATCTGTTGTCTAAATACG
CGTCTTAGTATATTTAACTTGCCCATCATCGGCATCATCACATATCATTACAGCAATTAGGTTGCCGCTGCGGGTATTAATACTGGTCTTGCTCTTTTCCCCTTTTTTTGTTCCTTTCTA
ATATTAAGTTTCTACCTTTTTATCTCTCATTTGCAGTTTTTGATTGGACGAGATGGCCAAGTCCTTCAAAGATACAGAGCTCAAACATACCCATTGAGCATTGCCAATGACATCGAAATG
GCGTTGGATAAAGACTACCCCTTCACTGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGCTGAGTTCCTTCTTCCTCGCCCTCGCCCTGCGGGCCCCGCTCGACTGCGCTGCCACCGATGTCGAAGGATTCTACGCCATTTCCGCGATGGACATTGACGGAAACTATGTG
TCGCTCTCCAAGTACAGCGGCACGGTGTCCCTGGTGGTGAATGTGGCGAGCAAATGCGGGCTTACGAAATCG
AATTACGAACAACTATCTCAACTCCAAAATAGATTTGGCCCTCGTGGA
TTCCAAGTTCTGGCTTTCCCTTGCAATCAATTCAACTCTCAAGAGCCTGGTATGTTTAGA
AGCTCAAACGAGGAAGTGAAGCGCTTTGCAATTCAAAGCGGTGCAAACTATCCCCTTTTT
GCAAAATTGACTGTGAATGAACCCATGTGCAAGGATGGAGGGTTAGAGGATTGTTCTTCCTCATCCTCCCAATGCTGCTCCGCCAACAACAGTATCTACACTTACCTCAAATCCGCATTC
AAGGGCGACATCGATTGGAACTTCGCCAAA
TTTTTGATTGGACGAGATGGCCAAGTCCTTCAAAGATACAGAGCTCAAACATACCCATTGAGCATTGCCAATGACATCGAAATGGCGTTG
GATAAAGACTACCCCTTCACTGTTTGA

Retrieve as FASTA