Entry information : Kfl1CysPrx01 (kfl00806_0010)
Entry ID 12588
Creation 2013-12-02 (Qiang Li)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: Kfl1CysPrx01 (kfl00806_0010)
Name (synonym) Kfl1CysPrx01 (kfl00806_0010)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Kfl1CysPrx01
start..stop
S start..stop
Ppa1CysPrx01 315 4e-111 1..195 1..195
Ppa1CysPrx03 308 2e-108 1..193 1..193
Mp1CysPrx01 300 3e-105 1..193 1..193
Cpsl1CysPrx01 291 1e-101 1..196 16..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5830..5931 102 N° 2 5232..5259 28 N° 3 4603..4644 42 N° 4 3936..4119 184
N° 5 3181..3286 106 N° 6 2101..2225 125 N° 7 2022..2033 12 N° 8 493..496 4
complement(join(493..496,2022..2033,2101..2225,3181..3286,3936..4119,4603..4644, 5232..5259,5830..5931))


exon

Literature and cross-references Kfl1CysPrx01 (kfl00806_0010)
Literature From genomic project of Delwiche.
Protein sequence: Kfl1CysPrx01 (kfl00806_0010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   21990.42  
PI (pH):   %s   5.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LALSCSCAAFFPLLSLSGAGLVN*VPGSDDPELPWTLSILMAKKHGGVSDMHWFVFWYVYEILYQTIF*KLLNLLSSAVCTTELGAVAKYLPGEQTWTFLKYWNATISSSFYMC*T*SPSLTNCRFVEVVPCKDILPL*LVX

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2







ATGGGTCTCAAGCTGGGAGACACGTTCCCTGATTTCACTGCTGACTCGTCTCAAGGACAAATCCATTGGCATGAGTTCATTGACGGGTCATGGGCAATCTTGGTAAGTTGTGCATTTTTT
TCTGGTCACCAGTTGAGTTTGCAGGACCAAATTGAGTTGCAATTGCACTGAAGGTGGTTTCATGTGGATTTGAAATTCATGCACTTCTTAGAACACCTAAAAATAGCAGCTTCTTTTGGA
AGATACCGTTTCAGCTGAATAATGAGTAGAATAAACCCAGAGCGAGAGTGTTTTTTTCACACAGTGGTGATAGAAACAGCCAGGAGACAGCTGCACATACTGAGTAGAAGAAACCCCACT
CCAATCTGGAGCAAAATGCTCAGCGGCCATGCTCCATTTTCTATTGGCTTTATCGTGTTCATGTGCTGCATTCTTCCCCCTGCTGAGCTTAAGTGGAGCAGGGCTTGTCAACTAAGTGCC
GGGGTCCGATGACCCAGAACTTCCTTGGACGCTTTCAATTCTGATGGCAAAAAAACATGGTGGCGTGTCTGACATGCATTGGTTCGTATTTTGGTACGTATATGAGA
CTCTAAATCCCTT
GCGTTTTGTATCTTTCTTCTTGTGTTTCATCTGGACGCTCCTGTAATGATGTATGAACCCTCTGATGTGCAGTTTTCACACCCTGCCGACTTCACCCCAGGTCAGCTATCATCGCAATCA
CTTCAAGAACCTATCAATTCAGCACTGTCACCACAACTCAAAAGTCAGAGCCAACTGGCCATGCCTCACACATGAGTGCCCCATAGTCCCTGGACATAATGCATCTAGAGTAGCATGACT
CTTCCATCGTACTTATGTTGTGAAGCCTGCGGCGTTGCTTTTTCTGATCGGTTCTGTTACGTATCTCTTTTCGTAGCGGAGGAGACGAGCCATTTGTTCATACAGCATCTTTGTATCCAT
ATCTTGGATGGCGAGGAAAATCCTAGTACTTTAAGCATATCTTGCTGGAGCCTGCGGGACGAAGCTAGAGAAGGATGACACAAAAGGGTGATGGGGGAAAACAGCAGGATGTTTGTTGCA
GTGAGAATATTGACAGGCTTTCCACTCTTATTCAGAATCAGAGGGTCTCGTCACATTTATATGCTCAAGTTTAAAGAAACAAAAGCTAAGCTTAACCAAACTGAATTTGCTTCATGACTT
TGATCATTGTAACCAAGACAACCTTCTGCAATCAGGTTCTCTACCAGACTATCTTTTAAAAGTTGCTAAACCTGCTGTCGTCTGCAGTTTGCACCACGGAGCTTGGGGCTGTTGCCAAGT
ACTTGCCAGGTGAGCAAACTTG
CATACCAGCCTCTGAGAGCCACAAGAAAATGGCGACACCCTCCCCTCGTTTATTGCAGTTCTTTTGTGAATTTCATTTTGAAGAAGTCAATACAGTTG
TATGTGACTTTTTGTCTGTGCTCAGAATTGCTACAGTATGCAAAGCGTCCATTGGCTCAGCACATGATTCCACAGCAGCGTTGTTAATTATTTAGTACTTTGGTAAAAGCTCCTGCTGAT
GTGTCGCATTATAGCAGATCAACACTGGCGAGTTGGAATCTGTGGCTTGAAGATAGTAAACCTCCAAACTTTGAATTTGATCCAACCTTGTCTTGATATATCGCCTGAGGAGCAAGAAGA
ATTTTATTCCTGACCAAGAAAAAGGGGTCTCCGGTATTCTTTTCTGAGCAGGAACTCCACAGATGCTGGTCAATTCTACTCAAAAGTCCTGAAAACTCCCCGTTCATCTCTCTGCATTCG
CTTTCTATCCAGAGTTTGAGAAGCGCGGTGTGAAGTTGGCCGCCATTAGCCACAACGACGTCGAGTCCCACAAGGGTTGGATTCCCGACATTGAGACCTACACTCCGGGTGTCAAGGTTG
GGTACCCCATCATTGCGGACCCGGAGAAGGAGCTCGCCGTCAAGCTGGGGAGCCTAGACCCTGACGAGAAGGATGCGTAAGTCTCCCGGCGTTTCTCCCCGGAATGCTCGGCTTTGTTTT
GTGGTCCAGACTGCTTGAAGTTGCATTTTCGAATAGACAACGTGGACCTTGTTTTCGGAGCTTGCACGCAAGTCTTGTGGTCATTCCTTGGGCATTTGGGCCATTTAGCCACGGAACGAT
GTATCAGCTCTGCTTGTGAATGACGAGACATCTGAAAGGGCAAGTCATTGTAGTCCTACAATGTTTCTTAAGCTTTCCATACGTGCTTCTTATGCATTCGAACAATGTTCAGCTGTGCTT
TGCCTGATGGGAGATCTGACTTTTCTGAAGTACTGGAACGCTACAATCTCATCAAGCTTCTATATGTGCTGAACTTGATCGCCCTCGCTGACTAATTGCAGATTCGTTGAGGTCGTGCCT
TGTAAGGATATTTTGCCAAGTC
TCTACTCGCTTTCTCCAAAGATTGAGAAGACTTCGTCCTTAGGATTATTCGTTTAGTCAAAGTCTCGTTTGACTGGTTTGTTCACTTGAGACGCCAAG
CAGTGTCCAACGAGACCAACCAGTCCGGCCCGGAAGCTTCTTGGTTCGCTAGAATCCCGGTTTCTTGAGTACTTGAGGAGGGTGAACGGAGCGACTTGAAACCGAGCCACGTGGTTCTTT
TGCAGCAAGGGCCTCCCAGCCAATGCACGTGCCGTGTGGATCATTGGGCCGGACAAGAAGCTCAAGCTGTCCATCCTGTACCCCGCAACTACAGGTCGCAACTTTGAGGAGGTACGGTGC
TTTTGTCGACAACGGTAGACTTCTCAAAGAGATTGTTGACCCTAAATAAGTCTGCATGGCAATCGTGGCGCCCTAAGCCAGCATCATCTGATTGCGTGACCTGCAAAGTCAATTTGTTTG
ACTTACTAACTCTAAGTTAAGGTTCTCCGTCGATTACGGGTGACTGGCCTTGGATTGCACCAGTGACCCCAGCGCGAAAAGATTTATCAAGACTCAAAAGTCTTCAGTCGAAGTGTTGCG
ATCCTGTAGCCTCTAGGAACATGCTTGTCATTGACTCTACTCAGGAAATCAGAAATCGTTGTCAAAAGGCTTCTGACGTAAAATCTGGCCTTACTAGAAAATTATCCCAGTACTGACAGG
ACTACCGTGCTTTTCACCCTGAGTCTACAAGGTGGTAGTCTTCATATATGCGCTGATCGCTCCCTTATGTTGTCATTACTATTAATATTATTAGGGCTTCTTGTAGAATGCTCACGTTTG
ACTTCCGCTTCATGTGGATTCTCGACCTTCACCTAAACCAACCTTATTTCGCCAATTGCTGCACGTGCTGGATTCATCTCAGCTGCCTTTTAAGCACAGCCCGGCTTTTTATTGTGCTCT
TTCATCTGAATGCAACCTTAAGCCGTAACATAACCCTACCTCAAATGAGACTTTTACTCGCCTCTCCACGTGCTGCGCGTGGTGGACTCGCTGCAGCTGATGGCCAAGCACACCTCTGTC
ACCAGCAGTAACCTGATTTCCTGGCCTCTTTTCTGCTGACGGTCAAGCAACAAACGGACCCTAACCTGATTCGAAACTATCTTAACCCCCCTTCTTCAGGTACTGCGCGTGCTGGCACGC
TCCAGCTGACGGCCAAGCACAGCGGTGCGACCCCTTTCCAGCTTACGATCAACATTTGACAGACCTGGTCTTAACGTGATTCACAGTTACTGTTAACCCGCTTCAGGTGCTACGCGTGCT
GGACTCGCTCCAGCTGACGGCCAAGCACAGCGTGGCGACCCCCGTCAACTGGCACCACGGCGAGAAGGTGATCATCGTGCCGTCCATCAGCGACGAGGCCGCCAAGGAGAAGTTCCCCAA
GGGCTACGACACCTTTGACGTGCCCTCCGGCAAGAAGTACATCCGGGTCACGCCGCAGCCGAACATCTAGGTGAGAAACGCTCGTTTCGTCTTTTTTGTATCATGTTCCAAGGTGTTGAG
CTGCCCCTTCTTCCTTCTGCATTTTCATTTTGAAGTTGTTGCGTCCAGAAGTTTACAGGTCCCGAGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2



TTGGCTTTATCGTGTTCATGTGCTGCATTCTTCCCCCTGCTGAGCTTAAGTGGAGCAGGGCTTGTCAACTAAGTGCCGGGGTCCGATGACCCAGAACTTCCTTGGACGCTTTCAATTCTG
ATGGCAAAAAAACATGGTGGCGTGTCTGACATGCATTGGTTCGTATTTTGGTACGTATATGAGA
TTCTCTACCAGACTATCTTTTAAAAGTTGCTAAACCTGCTGTCGTCTGCAGTTTGC
ACCACGGAGCTTGGGGCTGTTGCCAAGTACTTGCCAGGTGAGCAAACTTG
GACTTTTCTGAAGTACTGGAACGCTACAATCTCATCAAGCTTCTATATGTGCTGAACTTGATCGCCCTCG
CTGACTAATTGCAGATTCGTTGAGGTCGTGCCTTGTAAGGATATTTTGCCAAGTC
TTTGACTGGTTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTTGCGCAT AGAGGCCGCA GTGCGGTATG GCCCTGGCCT GTATCAGTGT ATGCTCGCTC TGCGTCGTTT TCCAGAAGCT CGGTAGGTAC TTTTCAGATT CTGCAATTGC AACTTTAAGT  TTAACCGAAG GCGCCCTCCT TTGAAGAGAA ACCTTCTGTC GACGTTCTCT GAGATCAAGG AATATGGGTC TCAAGCTGGG AGACACGTTC CCTGATTTCA CTGCTGACTC GTCTCAAGGA  CAAATCCATT GGCATGAGTT CATTGACGGG TCATGGGCAA TCTTGTTTTC ACACCCTGCC GACTTCACCC CAGTTTGCAC CACGGAGCTT GGGGCTGTTG CCAAGTACTT GCCAGAGTTT  GAGAAGCGCG GTGTGAAGTT GGCCGCCATT AGCCACAACG ACGTCGAGTC CCACAAGGGT TGGATTCCCG ACATTGAGAC CTACACTCCG GGTGTCAAGG TTGGGTACCC CATCATTGCG  GACCCGGAGA AGGAGCTCGC CGTCAAGCTG GGGAGCCTAG ACCCTGACGA GAAGGATGCC AAGGGCCTCC CAGCCAATGC ACGTGCCGTG TGGATCATTG GGCCGGACAA GAAGCTCAAG  CTGTCCATCC TGTACCCCGC AACTACAGGT CGCAACTTTG AGGAGGTGCT ACGCGTGCTG GACTCGCTCC AGCTGACGGC CAAGCACAGC GTGGCGACCC CCGTCAACTG GCACCACGGC 
GAGAAGGTGA TCATCGTGCC GTCCATCAGC GACGAGGCCG CCAAGGAGAA CCGAACATCT AGATGA 

Retrieve as FASTA