Entry information : SbreGPx01
Entry ID 12590
Creation 2013-12-15 (Christophe Dunand)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: SbreGPx01
Name SbreGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Suillaceae Suillus
Organism Suillus brevipes    [TaxId: 48565 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbreGPx01
start..stop
S start..stop
SlutGPx01 343 1e-123 1..166 1..166
HpinGPx01 297 2e-105 4..165 2..163
XbadGPx01 296 3e-105 3..166 2..165
GliviGPx01 292 2e-103 4..164 2..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 142944..143065 122 N° 2 142868..142890 23 N° 3 142747..142814 68 N° 4 142513..142686 174
N° 5 142338..142451 114  
complement(join(142338..142451,142513..142686,142747..142814,142868..142890,1429 44..143065))


exon

Literature and cross-references SbreGPx01
Cluster/Prediction ref. JGI gene:   731599
Protein sequence: SbreGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18544.35  
PI (pH):   %s   8.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSSETTFYGLKTELPSGQTYDFEQLKGKVVLIVNVASKCGFTPQYGLQALYDKYKERDFVILGFPCNFGGQEPGDDAAIASFCELNHGVNFPLMKKSDVNGDNTNPVYQWLKNEKPGLMGLSRIKWNFEKFLIDKNGKVVNRWASTTTPQAIDAVVEKLLAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTTCTTCTGAAACCACTTTTTATGGTCTGAAAACAGAGTTACCTAGCGGGCAAACGTATGATTTTGAACAGCTCAAAGGAAAAGTTGTCTTGATTGTCAATGTTGCATCGAAG
TG
GTAAGTCGTAACTATGGTAGACCTACGAACGACTCACTCTCTAGATTTTCCAGTGGGTTCACTCCACAATACAAAGGTGCAGCATATAGTTCTCGAAGTTGATATGCAACTGACAAGG
ACACCTACTAGGCCTCCAGGCTCTGTACGACAAATACAAGGAACGTGATTTCGTCATTCTCGGTTTCCCATGCAACCAGGTTGGTCTGCGCTGCTCCAGCCAGTATTTCACTGCTATAGA
ACTTAGCAATGTCCAACAGTTTGGCGGCCAAGAGCCTGGTGACGATGCCGCTATTGCATCTTTCTGCGAACTCAATCACGGAGTAAACTTTCCTCTTATGAAGAAGTCTGACGTAAACGG
CGACAACACGAACCCTGTTTACCAATGGCTCAAGAATGAGAAGCCTGGCCTTATGGGCCTCTCTAGAATTAAG
GTTCGTTGTATGGGACTGGATCGCCGATGTGCATGCAGCTAACGCAA
CGTCACACTCGCAGTGGAACTTCGAGAAGTTCTTGATTGATAAGAACGGGAAAGTTGTGAACCGTTGGGCATCAACGACTACTCCTCAGGCGATTGATGCTGTAGTGGAGAAGCTTCTTG
CTGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTTCTTCTGAAACCACTTTTTATGGTCTGAAAACAGAGTTACCTAGCGGGCAAACGTATGATTTTGAACAGCTCAAAGGAAAAGTTGTCTTGATTGTCAATGTTGCATCGAAG
TG
TGGGTTCACTCCACAATACAAAGGCCTCCAGGCTCTGTACGACAAATACAAGGAACGTGATTTCGTCATTCTCGGTTTCCCATGCAACCAGTTTGGCGGCCAAGAGCCTGGTGACGAT
GCCGCTATTGCATCTTTCTGCGAACTCAATCACGGAGTAAACTTTCCTCTTATGAAGAAGTCTGACGTAAACGGCGACAACACGAACCCTGTTTACCAATGGCTCAAGAATGAGAAGCCT
GGCCTTATGGGCCTCTCTAGAATTAAG
TGGAACTTCGAGAAGTTCTTGATTGATAAGAACGGGAAAGTTGTGAACCGTTGGGCATCAACGACTACTCCTCAGGCGATTGATGCTGTAGTG
GAGAAGCTTCTTGCTGAGTGA

Retrieve as FASTA