Entry information : PabPrx134(PAB00031610 / MA_20223g0020)
Entry ID 12672
Creation 2013-12-19 (Qiang Li)
Last sequence changes 2013-12-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-01-19 (Christophe Dunand)
Peroxidase information: PabPrx134(PAB00031610 / MA_20223g0020)
Name PabPrx134(PAB00031610 / MA_20223g0020)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Pinaceae Picea
Organism Picea abies (Norway spruce)    [TaxId: 3329 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PabPrx134
start..stop
S start..stop
PsiPrx05 698 0 1..344 1..344
PpPrx05 594 0 11..344 1..334
PtaPrx12 583 0 1..344 1..344
PabPrx62 569 0 23..342 27..346
Literature and cross-references PabPrx134(PAB00031610 / MA_20223g0020)
Protein sequence: PabPrx134(PAB00031610 / MA_20223g0020)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (311)
PWM (Da):   %s   37696.4 (33912.4)  
PI (pH):   %s   9.53 (9.19) Peptide Signal:   %s   cut: 29 range:29-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MANTIWRRLT LLQLVCSLQA FFISSSFGHP LPHPGHYPVS SLIPHYYAKS CPRAEQIVAS VVQKAVMKET RMAASLLRLH FHDCFVKGCD ASLLLDDTGS IVSEKRSNPN RNSARGFEVV  DQIKSALEQA CPKTVSCADI LAISARDSVV LRGGLGWEVL LGRRDSKSAS LSGSNNNIPA PNSTLQTLTT KFKLQGLNEV DLVALSGSHT IGLSRCTSFR QRLYNQSGNG QPDFTLDKSY 
ATQLKSGCPK SGGDNNLFPL DFVSPTKFDN YYFKNLLSGH GLLNTDEELF SKGQAKTRKL VKEYAENEEL FLKQFALSMV KLGNIKPLTG SNGEIRVNCR KVNS 

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction (contains an extra repeat in 3' (NGQPDFTLDKSYATQLRSGCPKSGGDNNLFPLDFVSPTKFDNYYFKNLLSGHGLLNTDEELFSKGQAKTRKLVKEYAENKELFLKQYALSMVKMGNMKPLTGSKGEIRVNCRKVNS).
DNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCCAACA CTATTTGGCG CCGTCTCACT CTATTGCAGC TAGTTTGTTC GCTGCAGGCA TTCTTCATAT CGTCCTCATT TGGCCATCCT CTGCCTCATC CGGGTCATTA TCCTGTTAGT  AGTTTGATTC CACATTATTA TGCCAAGTCA TGTCCCAGGG CCGAGCAAAT AGTGGCATCA GTAGTACAGA AGGCCGTGAT GAAGGAAACT CGAATGGCAG CGTCTTTACT CAGGCTTCAT  TTCCATGATT GCTTTGTCAA GGTGATCCTT ATTATTTTCG TCATGCAGAT TGATACTAGT ATTGATTACT CATGAATTCC TAACAATAAA ATGTATGTAT GTGTGTGTAT GATAGGGGTG  CGATGCATCT TTGCTACTGG ATGACACTGG AAGCATTGTG AGTGAGAAGA GATCGAATCC CAACAGAAAC TCTGCCAGAG GATTTGAAGT CGTTGATCAG ATAAAGAGTG CACTGGAGCA  GGCGTGCCCA AAAACTGTAT CCTGTGCAGA TATTCTTGCT ATTTCAGCTC GTGACTCAGT GGTCCTGGTA ATAAATTACA TATCAATCTC TTTACTAGTC AATATTTCAT TCATTGAAAA  GAACATACAT ACATATTTGC TAGTGCTGGT TTCCAAGCCA TGAATATAGG AGTAAATTAT AATGCAATGC CTAGTGATGT GTAAATCTAA GTGCCCAGTC AATCCTGTAT AAAAATCAGA  GAGGAGGTCT GGGCTGGGAA GTTTTACTGG GGAGGAGAGA CTCGAAGAGT GCAAGTTTGA GTGGATCCAA CAACAATATC CCAGCGCCCA ACTCAACTCT CCAGACTCTT ACTACCAAGT  TTAAACTACA AGGTCTGAAT GAGGTAGACT TGGTGGCCCT TTCAGGTATA TATATATTGT ATTTAACTGC ACCCTCCTAA TATGTAGTAC ATTCAATTCG TTTTGTAGCA TTCAATTTTA  GGTAGAGATT ATGAAGTATA GAAATGTAAA TGCAAATGCT AATTACCCAG GGAGTCACAC CATCGGCCTA TCTCGATGCA CAAGTTTCAG GCAGAGGCTT TACAACCAAA GTGGAAATGG  GCAGCCAGAC TTCACTCTAG ACAAGTCGTA CGCTACTCAG CTCAAATCCG GATGTCCGAA ATCGGGAGGA GATAATAACT TGTTCCCATT GGATTTTGTG AGTCCTACCA AATTCGACAA  CTACTACTTC AAGAACTTGC TGAGCGGGCA TGGACTGTTG AACACAGACG AAGAATTGTT CTCCAAGGGC CAAGCGAAGA CGAGGAAACT AGTGAAAGAG TATGCAGAAA ACGAGGAGCT 
CTTTCTCAAA CAGTTTGCAT TATCTATGGT GAAGCTGGGG AACATAAAGC CTCTTACAGG CTCCAACGGA GAAATCAGGG TCAACTGTCG TAAAGTTAAC AGTTGA 

Retrieve as FASTA  
CDS
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCCAACA CTATTTGGCG CCGTCTCACT CTATTGCAGC TAGTTTGTTC GCTGCAGGCA TTCTTCATAT CGTCCTCATT TGGCCATCCT CTGCCTCATC CGGGTCATTA TCCTGTTAGT  AGTTTGATTC CACATTATTA TGCCAAGTCA TGTCCCAGGG CCGAGCAAAT AGTGGCATCA GTAGTACAGA AGGCCGTGAT GAAGGAAACT CGAATGGCAG CGTCTTTACT CAGGCTTCAT  TTCCATGATT GCTTTGTCAA GGGGTGCGAT GCATCTTTGC TACTGGATGA CACTGGAAGC ATTGTGAGTG AGAAGAGATC GAATCCCAAC AGAAACTCTG CCAGAGGATT TGAAGTCGTT  GATCAGATAA AGAGTGCACT GGAGCAGGCG TGCCCAAAAA CTGTATCCTG TGCAGATATT CTTGCTATTT CAGCTCGTGA CTCAGTGGTC CTGAGAGGAG GTCTGGGCTG GGAAGTTTTA  CTGGGGAGGA GAGACTCGAA GAGTGCAAGT TTGAGTGGAT CCAACAACAA TATCCCAGCG CCCAACTCAA CTCTCCAGAC TCTTACTACC AAGTTTAAAC TACAAGGTCT GAATGAGGTA  GACTTGGTGG CCCTTTCAGG GAGTCACACC ATCGGCCTAT CTCGATGCAC AAGTTTCAGG CAGAGGCTTT ACAACCAAAG TGGAAATGGG CAGCCAGACT TCACTCTAGA CAAGTCGTAC  GCTACTCAGC TCAAATCCGG ATGTCCGAAA TCGGGAGGAG ATAATAACTT GTTCCCATTG GATTTTGTGA GTCCTACCAA ATTCGACAAC TACTACTTCA AGAACTTGCT GAGCGGGCAT  GGACTGTTGA ACACAGACGA AGAATTGTTC TCCAAGGGCC AAGCGAAGAC GAGGAAACTA GTGAAAGAGT ATGCAGAAAA CGAGGAGCTC TTTCTCAAAC AGTTTGCATT ATCTATGGTG 
AAGCTGGGGA ACATAAAGCC TCTTACAGGC TCCAACGGAG AAATCAGGGT CAACTGTCGT AAAGTTAACA GTTGA 

Retrieve as FASTA