Entry information : KflPrx02 (kfl00035_0330)
Entry ID 12840
Creation 2013-12-31 (Christophe Dunand)
Last sequence changes 2014-08-20 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-09-02 (Qiang Li)
Peroxidase information: KflPrx02 (kfl00035_0330)
Name (synonym) KflPrx02 (kfl00035_0330)
Class Class III peroxidase    [Orthogroup: Prx225]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrx02
start..stop
S start..stop
KflPrx01 277 2e-92 27..269 23..263
CsaPrx01 134 3e-37 65..306 36..288
LvPrx49 125 2e-34 39..266 31..270
PvPrx16 127 2e-34 66..265 56..264
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..81 81 N° 2 389..491 103 N° 3 719..814 96 N° 4 1144..1214 71
N° 5 1472..1534 63 N° 6 1762..1881 120 N° 7 2055..2109 55 N° 8 2571..2649 79
N° 9 2990..3302 313  
join(1..81,389..491,719..814,1144..1214,1472..1534,1762..1881,2055..2109,2571..2 649,2990..3302)


exon

Literature and cross-references KflPrx02 (kfl00035_0330)
Cluster/Prediction ref. klebsormidium DB:   kfl00035_0330
Protein sequence: KflPrx02 (kfl00035_0330)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (296)
PWM (Da):   %s   35773.56 (32627.9) Transmb domain:   %s   i7-29o303-322i (o273-292i)
PI (pH):   %s   5.91 (5.64) Peptide Signal:   %s   cut: 31 range:31-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTNTWVCSALGLLLATLSLLCLLTTQVTGAELTHEQLFKFAPLPDGALPDEHVYTPGVRECIFQIIRKNLLTMSLKDERINAKFLRLIFHDCAAGGCNGSIMRTEEHNGTANEFLGFDEVRMVKAAIDTSCNVSISLADTIIAGGVEGVKETGGPDITAYVRFGRRDTDDRDDPNKLPLPFVSTDELVRVFAPLGLNVEDLVALSGAHTIGKATCKNIVARLGTDPTADPAFLFSLLPRCTALATQQLDLDAKTPEVFDKYYFQVRHANLLEWTLGPMALEGCRACSVRSSLRLLHPLFEIFWRPSLLFSATLLTLFVLLPRRA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect predict from KDB (very long 3'end). The prediction of the 3' need to be confirmed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAAACACCTGGGTTTGCTCAGCTTTGGGGCTGCTGCTCGCAACCCTCAGTCTTCTATGTCTTTTGACCACTCAGGTTCGTTTCTCTCTGACACTGCTGAAGGACTTAATATGA
ATGAGGTGACAGTAATAATCGAATCACACAAAGCTCATGATGGATACAGCAGCTGCATGAATCGACCTCCATGACTGATTATCGTTTTCGGCGAAGGTCATGGATAGGCCCAAAACATCA
TCTTCCTCTTTCAAGTGCTCTCTCCAATCAAAAGCTCTGCCTCCGATTGTGGCTAGATGTGTTGCTTCAATATACGCCGACAACGGATGCCTCCAGCTGCAAAGCTGAGCGTGATGCTGC
AAAATACCATTACACCCTCTGAGTGCAGGTGACTGGAGCAGAGTTGACACATGAGCAGCTGTTCAAGTTTGCTCCATTGCCCGATGGGGCGCTCCCCGATGAGCACGTTTACACACCAGG
CGTCCGAGAAT
GTGAGTGCAAAGAATCGAATCCGATTGAGCCACACTGTCTGCTAGGCAGAAGGTATCACTTTCAAGCTGGCTTGAAACTGGTAATTGACGTCCTGGTCAAAACCCTGAA
CGACTTGGAGGGGGTTACATGGTACCTAGTGATTGATACTAGGGTCGTATCATCTTTCTCCAGGAAAAAATATAGCTCAAGGCATGCTAAAACAGGGGTCTAATGCTGTCCTGTGCAGGC
ATCTTCCAGATCATCCGGAAGAACTTACTGACCATGTCCCTCAAAGATGAGCGCATCAATGCCAAGTTCTTGCGGCTGATATTCCACGACTGCG
GTAAGCGCGATTTTATCTGGTGAGCA
TTTAATTGATTCCAATGAAATCGTTGTGAATGGGTTCTGGAATGTGTCCTATCAATCAATTCCGGTGAAGGACCTGCAAATCTTTTGTAGAGTTTTCAGCTCCCCTGATCTGGTTGCCTG
TTAACTCTGCCAACCTTTCCAACGAAAAGATACCCGTTTAGGGACGGATTACCAGAGTCTGTGTGGTCCACAGCTTATGTATAAGTTTGCATAATCCTCATCAATAAGCAACAGCTTATG
TACCCAGATCTGTCTGGCCAAACGGGCGCTTATGCATAATTGACTTATCGCTGATATGCGCAGCTGCTGGCGGCTGCAACGGGTCCATCATGCGGACAGAGGAGCACAATGGAACGGCAA
ACGAGTTTCTTACT
GTAAGTTGTCGTCCTCTTTTTCTTTCGACTGTTTGGTGCTGTTCAGCTTTCGAAAACATGTGGACACGATCTTGCCATTACTTCTGAATGCAGAGCACTTTGACAA
CCCTTTTTTATTGTTGGAAAGGTATGTGTATGTGACTTTCCAAAAGGTTGACGTTTCAGGAGAGCGAAGCTGCCTGACTGAGTATGATCCACTTCGAATGCCTCAAACAACAATGAAACG
ACCTTCTGACGTGCAATTTTCGAATCCGCAGGGGTTTGACGAGGTCCGTATGGTCAAAGCTGCAATTGATACCTCGTGCAACGTCAGCATCTCGGTGAGGCTTCCTTTACAAAGCTATGT
TGCCACTGATCATTCTTGTATCGAGGATCAAGGTTACCCTCGATCGCTTTTGTCAATACACTTTGTCTACGGCTTGACAAGATTTTTGCATACTATCAACATCGCTCACGCTAGTTCTGG
ATCTCTGGCAACGGGGTTGTCTTTGGAATTATCTCTGAGCAGCAAGCTCAAGCTCTCATCCAAAGTGTGCGTCCCTTGCAGCTTGCTGATACGATCATTGCTGGGGGAGTGGAAGGAGTG
AAGGAGACGGGTGGCCCTGACATCACGGCCTACGTCAGGTTCGGCAGGCGGGATACAGACGACCGAGACGATCCCAACAAA
GTGAGAAGTCCTGGAATTTCCGTCAGCATCGCAGCACTT
TTCAGGCAGATGTTTAAAGGGTTCTACTCGGGTTGGAATACTGCTCTGTTTTGGGTCGATCCGGCGATAAAAGATTATGTGCTTGGGCCGAATCATGGCTGTAAGGATGCTGACTTTCTT
CACCCTCTCTGCAGCTGCCGCTTCCGTTCGTCTCGACGGACGAGCTGGTCAGAGTTTTCGCTCCTCTCGGTAAGCCACGCTTGTCTTCAAGCCGACTCAACCAGTTTGGCGTTACTTCTT
CCCGTTCAATGCATTAGCGAGCTTCCGTTTCTCACTGTAACGCTGGGCCACCAGACTGAGGGCAATCAGATGTTAGCAATCACAAGCAACGGAGGCTGTCGCATGCTGTCGGAGGCTGCC
GGAGTCGAGTTAGTTGATATGACAATTGAGGGTCTTCTTAGCTGGTGGCTCGTAAAACTTCTTTCAGTTGAACAGCTTTCGACTATAGATGGTTCAGGAGCTCGAAACGAACTATGAGAA
GCTTTCCGAATCTACCGAGGAACAAAGCGCTGGTCGAGAACCTGCAGACGCCTGAGAATATTGAAAGTCCTACTGCTTTGTGTCCTAAAAAGCTCTCCTTTGCTACTTGAATCAAGCTCC
CTCAAACCCTGTGAGAGACTTGAGAGGTGAAGTACGCGCTGTCAGTGCAGGGCTCAACGTGGAGGACCTTGTGGCGCTTTCTGGGGCCCATACCATCGGCAAAGCCACGTGCAAGAACAT
CGTCGCCAG
GTAGGGCAGCGTCACCGGCGCCCAATCAAATACCATTTGTCTTTGAGAACACTAACATGCTGCGACGGTGTCGACACGTCACTTGATTGCGAGGTGTTTCGGAGACTGCCG
GAGGGAACGATTGGGAGATCCGTATGACATCTTGCGGATCCATTATCGTTCTCCAATTAAGCAACACAAGAACCTGCTGATCTGCCCTGTCTTTGTCAATGGTTGCAGCATATATCAATG
AAGGCACCATTATATGAAAGACCATAGACCTCTTCTACTGAAGGAAGTGAAGAGGAAAATGGTTCGAGACTTTCTTTCTCTCAAGGGTGTCTTCCTGGAACTTATGCAGGCTGGGAACCG
ATCCAACAGCCGACCCCGCTTTCCTGTTCAGCCTTCTGCCTAGATGCACAGCCCTGGCCACGCAGCAGCTCGATCTGGACGCCAAAACCCCTGAGGTCTTCGACAAGTACTACTTCCAGG
TGAGACATGCGAATCTGCTCGAATGGACGCTCGGACCGATGGCACTGGAAGGTTGTAGAGCATGCAGTGTGAGGTCGTCTCTTCGACTTCTCCATCCGCTCTTTGAAATATTCTGGCGTC
CCTCTCTTCTGTTCTCCGCGACTTTGCTCACGCTGTTCGTTCTCTTGCCGCGCAGGGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAAACACCTGGGTTTGCTCAGCTTTGGGGCTGCTGCTCGCAACCCTCAGTCTTCTATGTCTTTTGACCACTCAGGTGACTGGAGCAGAGTTGACACATGAGCAGCTGTTCAAG
TTTGCTCCATTGCCCGATGGGGCGCTCCCCGATGAGCACGTTTACACACCAGGCGTCCGAGAAT
GCATCTTCCAGATCATCCGGAAGAACTTACTGACCATGTCCCTCAAAGATGAGCGC
ATCAATGCCAAGTTCTTGCGGCTGATATTCCACGACTGCG
CTGCTGGCGGCTGCAACGGGTCCATCATGCGGACAGAGGAGCACAATGGAACGGCAAACGAGTTTCTTACTGGGTTTGAC
GAGGTCCGTATGGTCAAAGCTGCAATTGATACCTCGTGCAACGTCAGCATCTCG
CTTGCTGATACGATCATTGCTGGGGGAGTGGAAGGAGTGAAGGAGACGGGTGGCCCTGACATCACG
GCCTACGTCAGGTTCGGCAGGCGGGATACAGACGACCGAGACGATCCCAACAAA
CTGCCGCTTCCGTTCGTCTCGACGGACGAGCTGGTCAGAGTTTTCGCTCCTCTCGGGCTCAACGTG
GAGGACCTTGTGGCGCTTTCTGGGGCCCATACCATCGGCAAAGCCACGTGCAAGAACATCGTCGCCAG
GCTGGGAACCGATCCAACAGCCGACCCCGCTTTCCTGTTCAGCCTTCTGCCT
AGATGCACAGCCCTGGCCACGCAGCAGCTCGATCTGGACGCCAAAACCCCTGAGGTCTTCGACAAGTACTACTTCCAGGTGAGACATGCGAATCTGCTCGAATGGACGCTCGGACCGATG
GCACTGGAAGGTTGTAGAGCATGCAGTGTGAGGTCGTCTCTTCGACTTCTCCATCCGCTCTTTGAAATATTCTGGCGTCCCTCTCTTCTGTTCTCCGCGACTTTGCTCACGCTGTTCGTT
CTCTTGCCGCGCAGGGCCTGA

Retrieve as FASTA