Entry information : AeuGPx04_201684 (g4304.t1 / Ae201684_4304.1)
Entry ID 12856
Creation 2014-02-19 (Christophe Dunand)
Last sequence changes 2014-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-17 (Christophe Dunand)
Peroxidase information: AeuGPx04_201684 (g4304.t1 / Ae201684_4304.1)
Name (synonym) AeuGPx04_201684 (g4304.t1 / Ae201684_4304.1)
Class Other glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AeuGPx04_201684
start..stop
S start..stop
ZmGPx04 154 2e-47 13..176 62..229
CtaiGPx01_LMG19424 149 1e-46 23..171 3..155
TaGPx04-1A 151 2e-46 16..176 64..228
SbGPx04 151 2e-46 13..176 64..231
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 440140..440340 201 N° 2 440396..440542 147 N° 3 440589..440828 240  
join(440140..440340,440396..440542,440589..440828)


exon

Literature and cross-references AeuGPx04_201684 (g4304.t1 / Ae201684_4304.1)
Protein sequence: AeuGPx04_201684 (g4304.t1 / Ae201684_4304.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196 (177)
PWM (Da):   %s   22823.07 (20875.8)  
PI (pH):   %s   4.31 (4.29) Peptide Signal:   %s   cut: 19 range:19-195
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSLIVATLVALLALVVAETEKDIYHFMATKDNKDYPLANYDHTPVMLIVNVASECGFTDSNYRELQRLQDEYHVFGFEVLAFPCNQFGEQEPGTYDQIINFAQTKYNVNFNIFDKIDVNGPNSHPLYRWLKSSLDNKPVQWNFEKFIVVDGYPWKRYAYNVDFETLEEDILYALAHESEFHHPDNDPLEDHDEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). scaffold8
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAAGCTTGATTGTGGCCACGTTGGTGGCCTTGCTCGCTCTTGTTGTCGCCGAAACGGAAAAGGATATCTACCACTTTATGGCGACGAAGGACAACAAAGACTATCCACTTGCAAAT
TATGATCACACGCCCGTTATGCTTATTGTAAACGTGGCGAGTGAATGTGGCTTCACAGACTCCAACTACCGCGAATTGCAG
GTTTGTACAATCTTCCTCCCTCGTGGATCATGTACGAAG
CATGACGGATGTGTAGAGGTTGCAAGATGAATACCACGTCTTTGGCTTTGAAGTTTTGGCCTTCCCATGCAACCAATTCGGCGAACAAGAGCCTGGCACGTATGACCAAATTATCAACTT
TGCCCAGACAAAGTACAACGTCAACTTTAACATCTTTGACAAG
GTGCATAACCCACCAGACTGTACAGTCTGTGACTTGACGAGTGTAGATTGATGTGAACGGCCCCAACTCGCATCCAT
TGTATCGATGGCTCAAGTCTTCCCTTGACAACAAACCTGTCCAGTGGAACTTTGAAAAGTTTATCGTCGTGGATGGATACCCTTGGAAGCGCTATGCGTACAATGTGGACTTTGAGACTC
TTGAGGAAGACATCTTGTACGCCTTAGCGCATGAATCCGAGTTCCATCACCCAGACAACGATCCGCTTGAAGACCACGATGAACTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAAGCTTGATTGTGGCCACGTTGGTGGCCTTGCTCGCTCTTGTTGTCGCCGAAACGGAAAAGGATATCTACCACTTTATGGCGACGAAGGACAACAAAGACTATCCACTTGCAAAT
TATGATCACACGCCCGTTATGCTTATTGTAAACGTGGCGAGTGAATGTGGCTTCACAGACTCCAACTACCGCGAATTGCAG
AGGTTGCAAGATGAATACCACGTCTTTGGCTTTGAAGTT
TTGGCCTTCCCATGCAACCAATTCGGCGAACAAGAGCCTGGCACGTATGACCAAATTATCAACTTTGCCCAGACAAAGTACAACGTCAACTTTAACATCTTTGACAAG
ATTGATGTGAAC
GGCCCCAACTCGCATCCATTGTATCGATGGCTCAAGTCTTCCCTTGACAACAAACCTGTCCAGTGGAACTTTGAAAAGTTTATCGTCGTGGATGGATACCCTTGGAAGCGCTATGCGTAC
AATGTGGACTTTGAGACTCTTGAGGAAGACATCTTGTACGCCTTAGCGCATGAATCCGAGTTCCATCACCCAGACAACGATCCGCTTGAAGACCACGATGAACTTTAG

Retrieve as FASTA