Entry information : AeuGPx05_201684 ( Ae201684_11154.1)
Entry ID 12857
Creation 2014-02-19 (Christophe Dunand)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-17 (Achraf Jemmat)
Peroxidase information: AeuGPx05_201684 ( Ae201684_11154.1)
Name (synonym) AeuGPx05_201684 ( Ae201684_11154.1)
Class Other glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AeuGPx05_201684
start..stop
S start..stop
GprGPx01 127 7e-38 46..184 26..164
CtaiGPx02_LMG19424 120 1e-34 46..182 72..205
CtanzGPx01 119 2e-34 44..185 33..175
CcorGPx02 118 2e-34 46..186 22..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 196215..196370 156 N° 2 196029..196157 129 N° 3 195831..195979 149 N° 4 195643..195784 142
complement(join(195643..195784,195831..195979,196029..196157,196215..196370))


exon

Literature and cross-references AeuGPx05_201684 ( Ae201684_11154.1)
Cluster/Prediction ref. AphanoDB:   229430
Protein sequence: AeuGPx05_201684 ( Ae201684_11154.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   21685.27  
PI (pH):   %s   5.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIHGVVRRGILAPFLTRGIKNKKVFLPPLRQFKQVNTDTFLPSSLFQQKVVLVVNTASKCGFTPQLKSLQELHSKYASRGLTVLAVPSNDFGSQEPDNEETVEAFYKKEYNVEFPITKKYHVIGPDAHPFFNAIVDQYTEDVAPSWNFEKFFVDNTGDLRAVFPRDVDPLEPEVIETIENLLEELPKEQKQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold27, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCATGGAGTCGTCCGACGCGGCATCTTGGCGCCATTTCTGACGCGTGGAATCAAGAACAAGAAGGTTTTCTTGCCTCCGCTGCGTCAATTCAAGCAGGTGAACACGGATACGTTC
TTGCCATCATCGCTTTTCCAGCAGAAAGTCGTCCTG
GTACGAAAACGACAGAAGGGCGTAGAACGATGAAGCGACTGTACTTTCTATCTCTAGGTCGTCAACACGGCGTCCAAGTGTGGA
TTCACGCCGCAATTAAAATCGCTGCAAGAATTGCATTCCAAATATGCGTCGAGAGGATTGACTGTGCTTGCTGTACCCTCGAATGACTTTGGCAGCCAAGAG
GTGCGGTGTTCTCGTGTG
ATATCACAATAGCTCATTATCGGGACAATAGCCCGACAACGAAGAGACCGTCGAAGCATTCTACAAGAAAGAATACAACGTCGAGTTTCCCATCACCAAGAAATACCACGTGATCGGACC
TGATGCGCATCCTTTCTTCAATGCGATTGTTGATCAATACACGGAAGACGTTGCCCCATC
GTACGTTTCCTGGAATCATGGACATTCATCTTACTCATTTCTGAAGATGGAACTTTGAAA
AGTTCTTTGTTGACAACACTGGCGATTTGCGAGCCGTGTTTCCTCGTGACGTTGACCCCCTTGAGCCTGAAGTTATTGAAACAATTGAGAACCTTCTCGAAGAACTGCCAAAGGAACAAA
AACAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCATGGAGTCGTCCGACGCGGCATCTTGGCGCCATTTCTGACGCGTGGAATCAAGAACAAGAAGGTTTTCTTGCCTCCGCTGCGTCAATTCAAGCAGGTGAACACGGATACGTTC
TTGCCATCATCGCTTTTCCAGCAGAAAGTCGTCCTG
GTCGTCAACACGGCGTCCAAGTGTGGATTCACGCCGCAATTAAAATCGCTGCAAGAATTGCATTCCAAATATGCGTCGAGAGGA
TTGACTGTGCTTGCTGTACCCTCGAATGACTTTGGCAGCCAAGAG
CCCGACAACGAAGAGACCGTCGAAGCATTCTACAAGAAAGAATACAACGTCGAGTTTCCCATCACCAAGAAATAC
CACGTGATCGGACCTGATGCGCATCCTTTCTTCAATGCGATTGTTGATCAATACACGGAAGACGTTGCCCCATC
ATGGAACTTTGAAAAGTTCTTTGTTGACAACACTGGCGATTTGCGA
GCCGTGTTTCCTCGTGACGTTGACCCCCTTGAGCCTGAAGTTATTGAAACAATTGAGAACCTTCTCGAAGAACTGCCAAAGGAACAAAAACAATAA

Retrieve as FASTA