Entry information : Sdic1CysPrx01 (SDRG_01161)
Entry ID 12859
Creation 2014-02-26 (Christophe Dunand)
Last sequence changes 2014-02-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-03 (Christophe Dunand)
Peroxidase information: Sdic1CysPrx01 (SDRG_01161)
Name (synonym) Sdic1CysPrx01 (SDRG_01161)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Saprolegniaceae Saprolegnia
Organism Saprolegnia diclina    [TaxId: 112098 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sdic1CysPrx01
start..stop
S start..stop
Spar1CysPrx01 447 8e-163 1..225 1..225
Pul1CysPrx01 294 2e-102 7..225 9..227
Pi1CysPrx01 268 4e-92 8..224 6..222
Ppara1CysPrx01 266 2e-91 4..224 2..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172152..172304 153 N° 2 172031..172109 79 N° 3 171736..171980 245 N° 4 171483..171683 201
complement(join(171483..171683,171736..171980,172031..172109,172152..172304))


exon

Literature and cross-references Sdic1CysPrx01 (SDRG_01161)
DNA ref. GenBank:   JH767134.1 (172304..171483)
Protein sequence: Sdic1CysPrx01 (SDRG_01161)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   24903.79  
PI (pH):   %s   4.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPAPTLQVGMKIPKLVGSTQMGAIKLHDFIDGAWALLLTFPQDFHPVWITELGMLAKLKPQFDVRNCRVLGLSIGSLKNQARFLDDVNETQDTQVNFPIFADESGLLSRMLGLVNPTSAPSSADHAVLPYSAAFLMDVDMVIRFAFYYPMSIGRNLYFIRVLDGLQLAAYNQVVLPTNWKINDDVFVEPDISSEAAKALFPNGFHEIKPYFRVTPAPVLSEDQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCGGCGCCGACGCTCCAGGTCGGGATGAAAATCCCCAAGCTCGTGGGCTCGACGCAAATGGGTGCGATCAAGCTCCACGACTTCATCGACGGCGCGTGGGCGCTCCTCCTCACG
TTCCCCCAGGACTTCCACCCGGTCTGGATTACG
GTAGGTATATGGCTGCATTCGCATCCTCATCTGCACGTCTAGGAGCTGGGCATGCTCGCCAAGCTCAAGCCCCAGTTCGATGTGCGC
AACTGCCGCGTCCTCGGCCTCAGCATTGGCTCGC
GTCTGCTTGCTTCCTCCTCCGCATTGCGCGTCTCATGCTCGTCTTCGTAGTCAAGAACCAAGCGCGGTTCCTCGACGACGTCAACG
AGACGCAGGACACCCAAGTCAATTTCCCCATCTTTGCCGACGAGAGCGGTCTCCTTTCGCGCATGCTGGGGCTCGTGAACCCGACGTCCGCGCCGTCCAGCGCCGACCACGCGGTTCTGC
CCTACAGCGCGGCCTTTCTCATGGACGTCGACATGGTCATCCGCTTTGCCTTCTACTACCCCATGTCCATTGGCCGCAACCTTTATGAG
GTTGCACTGCATATATCTCTTCTTCATCCAT
CTCAGTGTCATCGACGACTAGTTTATTCGCGTCCTCGACGGGCTCCAGCTCGCGGCCTACAACCAGGTGGTGCTCCCGACCAACTGGAAGATCAACGACGACGTCTTTGTCGAGCCCGAC
ATTAGCTCCGAGGCCGCCAAGGCGCTCTTCCCCAACGGCTTCCACGAAATCAAGCCCTACTTCCGCGTGACCCCCGCGCCCGTCCTCTCGGAAGACCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCGGCGCCGACGCTCCAGGTCGGGATGAAAATCCCCAAGCTCGTGGGCTCGACGCAAATGGGTGCGATCAAGCTCCACGACTTCATCGACGGCGCGTGGGCGCTCCTCCTCACG
TTCCCCCAGGACTTCCACCCGGTCTGGATTACG
GAGCTGGGCATGCTCGCCAAGCTCAAGCCCCAGTTCGATGTGCGCAACTGCCGCGTCCTCGGCCTCAGCATTGGCTCGCTCAAGAAC
CAAGCGCGGTTCCTCGACGACGTCAACGAGACGCAGGACACCCAAGTCAATTTCCCCATCTTTGCCGACGAGAGCGGTCTCCTTTCGCGCATGCTGGGGCTCGTGAACCCGACGTCCGCG
CCGTCCAGCGCCGACCACGCGGTTCTGCCCTACAGCGCGGCCTTTCTCATGGACGTCGACATGGTCATCCGCTTTGCCTTCTACTACCCCATGTCCATTGGCCGCAACCTTTATGAG
TTT
ATTCGCGTCCTCGACGGGCTCCAGCTCGCGGCCTACAACCAGGTGGTGCTCCCGACCAACTGGAAGATCAACGACGACGTCTTTGTCGAGCCCGACATTAGCTCCGAGGCCGCCAAGGCG
CTCTTCCCCAACGGCTTCCACGAAATCAAGCCCTACTTCCGCGTGACCCCCGCGCCCGTCCTCTCGGAAGACCAGTAA

Retrieve as FASTA