Entry information : Sdic2CysPrx02 (SDRG_04285T0)
Entry ID 12861
Creation 2014-02-26 (Christophe Dunand)
Last sequence changes 2014-02-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-17 (Christophe Dunand)
Peroxidase information: Sdic2CysPrx02 (SDRG_04285T0)
Name (synonym) Sdic2CysPrx02 (SDRG_04285T0)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Saprolegniaceae Saprolegnia
Organism Saprolegnia diclina    [TaxId: 112098 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sdic2CysPrx02
start..stop
S start..stop
Gga2CysPrx03 250 2e-83 66..261 97..285
Xl2CysPrx03-1 248 3e-83 40..261 35..251
Xl2CysPrx03-2 248 6e-83 28..261 25..251
Egra2CysPrx01 246 6e-83 65..263 32..223
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 770017..770102 86 N° 2 770158..770254 97 N° 3 770304..770924 621  
join(770017..770102,770158..770254,770304..770924)


exon

Literature and cross-references Sdic2CysPrx02 (SDRG_04285T0)
DNA ref. GenBank:   JH767141.1 (770017..770924)
Protein sequence: Sdic2CysPrx02 (SDRG_04285T0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267 (245)
PWM (Da):   %s   29556.35 (27179.0)  
PI (pH):   %s   8.23 (7.21) Peptide Signal:   %s   cut: 23 range:23-267
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSLRTLLKMTLLLAALVAIHGLKEKTKSVGGLVPEIGLTEAQLAKLGYVKKNQHSSTSFVTPRKHAPQFHDVKSVVNEKFTTVSLDDYKGKWLVLFFYPFDFTFVCPTEIVSFSDSIKSFRSINAEVLAISTDSHHTHLAWIKTPREKGGLGKMNIPILADISKRISSDYGVLVTDEDDEMFGAALRGLFIIDPKGVVRSIQINDDQVGRSVDETLRILKAFSYADSHPGEVCPANWTPGSKTIKADQEAKYAFFEATYGNEKEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTCCTTGCGCACGCTCCTCAAGATGACGCTGCTCCTCGCGGCGCTCGTCGCCATCCATGGCCTCAAGGAGAAGACCAAGTCGTAAGATGCATGCGCCTGTCACTCGCAGGACGAT
GGCGGAACATGCGAATGCTAGGGTCGGTGGCCTCGTGCCCGAGATCGGGTTGACGGAAGCGCAGCTCGCCAAGCTCGGCTACGTCAAGAAGAACCAGCACTCGTCGACGTCGTTTCAAGT
AGTTGTGTATGGCCCACCACATGTAGGTGCTCATCGTAGTAGCGTAGGTGACGCCACGCAAGCATGCGCCGCAGTTCCATGACGTCAAGTCTGTGGTCAACGAGAAGTTCACGACGGTCT
CGCTCGACGACTACAAGGGCAAGTGGCTCGTGCTCTTCTTCTACCCGTTCGACTTTACGTTCGTGTGCCCGACCGAGATTGTGAGCTTCAGCGACTCGATCAAGAGCTTCCGCTCCATCA
ATGCCGAGGTGCTCGCGATCTCGACCGACTCGCACCACACGCACTTGGCGTGGATCAAGACGCCCCGCGAGAAGGGTGGTCTCGGCAAGATGAACATCCCGATCCTCGCTGATATCTCCA
AGCGCATCTCATCCGACTATGGTGTCCTCGTCACGGACGAAGACGACGAGATGTTTGGTGCGGCGCTCCGCGGTCTCTTCATCATCGACCCCAAGGGCGTGGTGCGCTCGATCCAGATCA
ACGACGACCAGGTCGGCCGCAGCGTCGACGAGACCTTGCGCATCCTCAAGGCATTCAGCTACGCCGATAGCCACCCTGGCGAGGTGTGCCCGGCCAACTGGACGCCCGGCTCCAAGACGA
TCAAGGCCGATCAAGAGGCCAAGTACGCGTTCTTCGAGGCGACGTACGGCAATGAGAAGGAGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTCCTTGCGCACGCTCCTCAAGATGACGCTGCTCCTCGCGGCGCTCGTCGCCATCCATGGCCTCAAGGAGAAGACCAAGTCGGTCGGTGGCCTCGTGCCCGAGATCGGGTTGACG
GAAGCGCAGCTCGCCAAGCTCGGCTACGTCAAGAAGAACCAGCACTCGTCGACGTCGTTTCAA
GTGACGCCACGCAAGCATGCGCCGCAGTTCCATGACGTCAAGTCTGTGGTCAACGAG
AAGTTCACGACGGTCTCGCTCGACGACTACAAGGGCAAGTGGCTCGTGCTCTTCTTCTACCCGTTCGACTTTACGTTCGTGTGCCCGACCGAGATTGTGAGCTTCAGCGACTCGATCAAG
AGCTTCCGCTCCATCAATGCCGAGGTGCTCGCGATCTCGACCGACTCGCACCACACGCACTTGGCGTGGATCAAGACGCCCCGCGAGAAGGGTGGTCTCGGCAAGATGAACATCCCGATC
CTCGCTGATATCTCCAAGCGCATCTCATCCGACTATGGTGTCCTCGTCACGGACGAAGACGACGAGATGTTTGGTGCGGCGCTCCGCGGTCTCTTCATCATCGACCCCAAGGGCGTGGTG
CGCTCGATCCAGATCAACGACGACCAGGTCGGCCGCAGCGTCGACGAGACCTTGCGCATCCTCAAGGCATTCAGCTACGCCGATAGCCACCCTGGCGAGGTGTGCCCGGCCAACTGGACG
CCCGGCTCCAAGACGATCAAGGCCGATCAAGAGGCCAAGTACGCGTTCTTCGAGGCGACGTACGGCAATGAGAAGGAGCTTTAA

Retrieve as FASTA