Entry information : AruPrx49-2 (HRP_08562.1)
Entry ID 12908
Creation 2014-05-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-05 (Christophe Dunand)
Peroxidase information: AruPrx49-2 (HRP_08562.1)
Name (synonym) AruPrx49-2 (HRP_08562.1)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx49-2
start..stop
S start..stop
AruPrx49-1 675 0 1..331 1..331
AalpPrx09 646 0 1..331 1..331
AhalPrx32 629 0 1..331 1..331
AtPrx49 626 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..228 225 N° 2 300..491 192 N° 3 561..726 166 N° 4 820..1232 413
join(4..228,300..491,561..726,820..1232)


exon

Literature and cross-references AruPrx49-2 (HRP_08562.1)
Literature Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW15
DNA ref. GenBank:   HE963824.1
Protein sequence: AruPrx49-2 (HRP_08562.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   35971.11 (33506.8)  
PI (pH):   %s   8.75 (8.92) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLTSILLLLSLLCFFPLCLCDKSYGGKLFPGFYAHSCPQAGEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGKIVSEKGSNPNSRSARGFDVVDQIKAELEKQCPGTVSCADALTLAARDSSVLTGGPSWVVSLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDIISAAKFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACTAGCATTCTCCTTCTTCTTTCTCTTTTATGCTTTTTCCCTCTCTGTCTCTGCGACAAGAGCTATGGAGGCAAACTCTTCCCTGGTTTTTACGCCCACTCATGCCCA
CAAGCCGGGGAAATCGTGAGATCAGTCGTAGCTAAAGCTGTTGCTAGAGAGACCCGTATGGCTGCTTCTTTGATGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTGGTTAATTTCT
TCTACGCCCACTATTCTAAAGATTTTTTTATTGAGCAAGGTAACTGTGAAATGCAGGGTTGTGATGGCTCTTTGCTTCTAGACAGCAGTGGGAAAATAGTGAGTGAGAAAGGCTCAAACC
CTAACAGCAGATCAGCTCGTGGGTTCGACGTAGTTGACCAAATCAAAGCTGAATTGGAGAAACAATGCCCTGGAACTGTTTCTTGCGCTGATGCTCTAACTCTAGCCGCTAGAGACTCCT
CTGTTCTT
GTAAGTCCCCTCCATAGTTTCCAAATCAAATTTAAAACATCAGCTAACTCGGTGTGGTTTTTGTTTTAGACCGGTGGACCGAGCTGGGTGGTTTCATTAGGAAGAAGAGATT
CAAGAAGTGCAAGCTTGAGTGGTTCGAACAACAATATCCCTGCACCAAACAACACTTTCCAGACCATTCTATCGAAGTTTAACCGTCAAGGACTCGATGTCACCGACCTTGTTGCTCTCT
CCG
GTAAGCTTTCTTCACTTGCACGCAACACAGTTAAAAGAAACCCCATTGCCTTACTTTTTTCTCAACCCACCACACTTCTTAACTGTTTCTCAGGGAGCCACACCATTGGATTCTCGA
GATGCACGAGTTTCAGACAAAGATTGTACAACCAGTCCGGAAACGGACGTCCAGACATGACATTGGAACAATCCTTCGCTGCTAACTTGCGCCAAAGGTGTCCGAGATCCGGCGGAGACC
AGATTCTCTCAGTGTTGGACATCATCAGCGCCGCGAAATTCGACAACAGCTACTTCAAGAACTTGATAGAAAACAAGGGTTTGTTGAACTCGGACCAGGTTTTGTTCAGCAGTAATGAGA
AATCTAGAGAGCTTGTGAAGAAGTATGCAGAGGACCAAGGAGAGTTTTTTGAGCAGTTTGCGGAATCGATGATCAAGATGGGAAATATATCTCCCTTGACGGGTTCGAGTGGCGAAATCA
GAAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACTAGCATTCTCCTTCTTCTTTCTCTTTTATGCTTTTTCCCTCTCTGTCTCTGCGACAAGAGCTATGGAGGCAAACTCTTCCCTGGTTTTTACGCCCACTCATGCCCA
CAAGCCGGGGAAATCGTGAGATCAGTCGTAGCTAAAGCTGTTGCTAGAGAGACCCGTATGGCTGCTTCTTTGATGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCT
TTGCTTCTAGACAGCAGTGGGAAAATAGTGAGTGAGAAAGGCTCAAACCCTAACAGCAGATCAGCTCGTGGGTTCGACGTAGTTGACCAAATCAAAGCTGAATTGGAGAAACAATGCCCT
GGAACTGTTTCTTGCGCTGATGCTCTAACTCTAGCCGCTAGAGACTCCTCTGTTCTT
ACCGGTGGACCGAGCTGGGTGGTTTCATTAGGAAGAAGAGATTCAAGAAGTGCAAGCTTGAGT
GGTTCGAACAACAATATCCCTGCACCAAACAACACTTTCCAGACCATTCTATCGAAGTTTAACCGTCAAGGACTCGATGTCACCGACCTTGTTGCTCTCTCCG
GGAGCCACACCATTGGA
TTCTCGAGATGCACGAGTTTCAGACAAAGATTGTACAACCAGTCCGGAAACGGACGTCCAGACATGACATTGGAACAATCCTTCGCTGCTAACTTGCGCCAAAGGTGTCCGAGATCCGGC
GGAGACCAGATTCTCTCAGTGTTGGACATCATCAGCGCCGCGAAATTCGACAACAGCTACTTCAAGAACTTGATAGAAAACAAGGGTTTGTTGAACTCGGACCAGGTTTTGTTCAGCAGT
AATGAGAAATCTAGAGAGCTTGTGAAGAAGTATGCAGAGGACCAAGGAGAGTTTTTTGAGCAGTTTGCGGAATCGATGATCAAGATGGGAAATATATCTCCCTTGACGGGTTCGAGTGGC
GAAATCAGAAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA