Entry information : AruPrx69-2 (HRP_17517.2)
Entry ID 12909
Creation 2014-05-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-05 (Christophe Dunand)
Peroxidase information: AruPrx69-2 (HRP_17517.2)
Name (synonym) AruPrx69-2 (HRP_17517.2)
Class Class III peroxidase    [Orthogroup: Prx061]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx69-2
start..stop
S start..stop
AruPrx69-1 653 0 1..323 1..323
BstrPrx15 565 0 1..323 1..333
ThPrx69 550 0 1..323 1..333
TsPrx69 550 0 1..323 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57..449 393 N° 2 537..696 160 N° 3 921..1339 419  
join(57..449,537..696,921..1339)


exon

Literature and cross-references AruPrx69-2 (HRP_17517.2)
Literature Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW60
DNA ref. GenBank:   HE963823.1
Protein sequence: AruPrx69-2 (HRP_17517.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34940.11 (32511.7) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.91 (9.76) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRGYNLLLILVTFLVLVAAVTARRPRVGFYGNRCRKVESIVRSVVRSHFRCNPANAPGILRMHFHDCFVNGCDGSILLAGNTSERTAGPNRSLRGFEAIEEAKTRLENACPNTVSCADILTLAARDAVVWTGGKGWSVPLGRLDGRRSEASDVNLPGPSDPVAKQKQDFAAKNLNTLDLVTLVGGHTIGTAGCGLVRGRFFNFNGTGQPDPSIDPSFVPLVQARCPQNGNATTRVDLDTGSAGDFDTSYLSNVRSSRVVLQSDLVLWKDTETRAIIERLLGLRRPVLRFGSEFGKSMTKMSLIEVKTRLSDGEIRRVCSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGGTTATAATTTACTATTAATTCTAGTTACGTTTTTAGTATTGGTCGCAGCTGTAACCGCTCGAAGACCACGAGTTGGGTTTTATGGGAATAGATGCCGAAAGGTAGAGTCT
ATCGTGAGATCGGTGGTTCGATCTCATTTCCGGTGTAATCCGGCAAATGCACCGGGAATTTTGCGTATGCATTTTCACGATTGTTTTGTCAATGGCTGCGATGGCTCGATCCTCCTCGCT
GGTAACACTTCGGAGAGAACTGCGGGTCCTAACCGTTCATTGAGAGGGTTCGAAGCTATTGAAGAAGCTAAGACTCGGCTTGAGAATGCTTGTCCTAATACCGTTTCTTGTGCGGATATC
CTCACCCTTGCTGCTCGAGACGCCGTCGTTTGG
GTAAAACATATTGAAATTAGTTTCAGTTTTAAGAAATTTTAATTATATATTGTGTGTTTAATGGTAATATAATTTTGGGTGATGCAG

ACCGGTGGAAAAGGTTGGTCGGTGCCATTGGGACGTCTTGACGGCCGAAGATCAGAAGCCTCAGATGTAAATTTGCCCGGACCAAGCGACCCCGTCGCTAAGCAGAAGCAAGACTTTGCA
GCTAAAAATCTCAACACCTTGGACCTCGTAACTCTTGTTG
GTTCGTTGTAATTATATATAATCAAACAATGTATATTAATCAAATAGTTACATATTTGGTCGGTTGTATTAAATTTTCGA
TACAGTTCTGATTACGTCGGTATGTATGAGGTTATGAAATATTTTTTTTCTTGATTTAAGTTTAGAAATTTAGTTTCAATTTGAACCGAATTCGGTTTACATGTTCAATTTTATTAGCTA
ATATTGCAAATTGATATTGATCAGGTGGACACACAATTGGAACTGCTGGTTGCGGTTTGGTAAGAGGCAGATTCTTTAACTTCAATGGCACGGGACAACCTGACCCATCAATCGACCCGA
GTTTCGTTCCTCTAGTTCAGGCTCGTTGCCCTCAAAACGGTAACGCAACGACCCGAGTCGACTTAGACACTGGAAGTGCAGGTGATTTCGATACATCGTACCTAAGTAACGTGAGGTCAA
GCCGCGTGGTTCTCCAATCCGATCTAGTCCTGTGGAAGGACACCGAAACCAGAGCCATCATAGAACGTTTATTAGGTTTACGCCGGCCCGTTTTGAGGTTCGGATCAGAATTTGGGAAGT
CGATGACCAAGATGAGTCTCATAGAAGTTAAGACTAGACTATCAGATGGGGAGATTCGTAGGGTTTGCTCTGCGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTGGTTATAATTTACTATTAATTCTAGTTACGTTTTTAGTATTGGTCGCAGCTGTAACCGCTCGAAGACCACGAGTTGGGTTTTATGGGAATAGATGCCGAAAGGTAGAGTCT
ATCGTGAGATCGGTGGTTCGATCTCATTTCCGGTGTAATCCGGCAAATGCACCGGGAATTTTGCGTATGCATTTTCACGATTGTTTTGTCAATGGCTGCGATGGCTCGATCCTCCTCGCT
GGTAACACTTCGGAGAGAACTGCGGGTCCTAACCGTTCATTGAGAGGGTTCGAAGCTATTGAAGAAGCTAAGACTCGGCTTGAGAATGCTTGTCCTAATACCGTTTCTTGTGCGGATATC
CTCACCCTTGCTGCTCGAGACGCCGTCGTTTGG
ACCGGTGGAAAAGGTTGGTCGGTGCCATTGGGACGTCTTGACGGCCGAAGATCAGAAGCCTCAGATGTAAATTTGCCCGGACCAAGC
GACCCCGTCGCTAAGCAGAAGCAAGACTTTGCAGCTAAAAATCTCAACACCTTGGACCTCGTAACTCTTGTTG
GTGGACACACAATTGGAACTGCTGGTTGCGGTTTGGTAAGAGGCAGA
TTCTTTAACTTCAATGGCACGGGACAACCTGACCCATCAATCGACCCGAGTTTCGTTCCTCTAGTTCAGGCTCGTTGCCCTCAAAACGGTAACGCAACGACCCGAGTCGACTTAGACACT
GGAAGTGCAGGTGATTTCGATACATCGTACCTAAGTAACGTGAGGTCAAGCCGCGTGGTTCTCCAATCCGATCTAGTCCTGTGGAAGGACACCGAAACCAGAGCCATCATAGAACGTTTA
TTAGGTTTACGCCGGCCCGTTTTGAGGTTCGGATCAGAATTTGGGAAGTCGATGACCAAGATGAGTCTCATAGAAGTTAAGACTAGACTATCAGATGGGGAGATTCGTAGGGTTTGCTCT
GCGATCAATTAA

Retrieve as FASTA