Entry information : AruPrx15 (HRP_6117)
Entry ID 12912
Creation 2014-05-05 (Christophe Dunand)
Last sequence changes 2014-05-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-05 (Christophe Dunand)
Peroxidase information: AruPrx15 (HRP_6117)
Name (synonym) AruPrx15 (HRP_6117)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx15
start..stop
S start..stop
AtPrx15 639 0 1..334 1..336
BstrPrx49 633 0 1..334 1..335
TsPrx15 633 0 1..335 1..336
AhalPrx05 632 0 1..334 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38..274 237 N° 2 370..561 192 N° 3 643..808 166 N° 4 914..1326 413
join(38..274,370..561,643..808,914..1326)


exon

Literature and cross-references AruPrx15 (HRP_6117)
Literature Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome. BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW32
DNA ref. GenBank:   HE963821.1
Protein sequence: AruPrx15 (HRP_6117)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (313)
PWM (Da):   %s   36246.64 (33940.4)  
PI (pH):   %s   5.76 (5.44) Peptide Signal:   %s   cut: 23 range:23-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIGSFLVVISLACVLTLCICDDESNYGGQGKLFPGFYSSSCPKAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTFNTILSRFNSQGLDLTNVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDTTLEQSYAANLRHRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNDESRELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSGQIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATTGGAAGCTTTCTCGTTGTTATCTCTCTCGCTTGCGTTCTTACTCTCTGCATCTGCGACGACGAGAGTAATTATGGCGGCCAAGGGAAACTCTTCCCAGGTTTCTACAGC
AGCTCGTGCCCTAAAGCTGAGGAGATCGTGAGGTCTGTTGTAGCCAAAGCTGTTGCAAGAGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTTCACGACTGTTTTGTTCAG
GTA
CTCAAGAGCTATTTTAAGTAACTTTCTCATCAAGCTAACGACTAATTTTGAGAATTTTAATTAATTATAGCTGTTTGCATAAAAATGTGTAGGGTTGTGATGGATCGTTGCTTCTAGACA
GCAGTGGAAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGCAGATCAGCTCGTGGGTTTGAAGTTGTTGACGAGATCAAAGCTGCATTGGAGAATGAATGCCCTAACACTGTTTCTT
GCGCTGACGCCCTAACTCTAGCCGCTAGAGACTCCTCTGTTCTT
GTAAGTCGCCTTATTCCACTTTCTCTCTTTACCGCTTCCTTAAGTTCTCAAGAGATCTAATTTTGTTCGGTTTGAA
TATAGACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGACAAGTGCAAGCTTGAGTGGATCAAATAACAACATTCCTGCACCAAACAACACTTTCAACACAATTCTCT
CGAGATTTAACAGCCAAGGTCTCGATCTCACCAATGTCGTTGCTCTCTCCG
GTAAGCTTACTTAAAACACAAGGAAAATTTTACTTTCCTTGCTACTCAAGTTAAAGTTAAATCCTAAAA
AGGATTTTAGTATAACCTGACTCAATTGTTTCTCAGGGAGCCACACAATTGGATTCTCAAGATGTACTAGTTTTAGACAGAGACTTTACAACCAATCCGGAAACGGAAGTCCCGACACAA
CCTTAGAGCAATCCTACGCTGCTAACTTGCGCCATCGGTGCCCTAGATCAGGTGGGGACCAGAACCTGTCGGAGCTTGACATCAACAGTGCTGGAAGGTTTGATAACAGCTACTTTAAGA
ATTTGATCGAGAACATGGGACTGTTGAATTCCGACCAGGTCTTGTTCTCTAGCAACGACGAATCGAGAGAGCTAGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCG
CGGAATCGATGGTCAAGATGGGGAATATCTCTCCCTTGACTGGTTCAAGTGGTCAAATCAGGAAGAATTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATTGGAAGCTTTCTCGTTGTTATCTCTCTCGCTTGCGTTCTTACTCTCTGCATCTGCGACGACGAGAGTAATTATGGCGGCCAAGGGAAACTCTTCCCAGGTTTCTACAGC
AGCTCGTGCCCTAAAGCTGAGGAGATCGTGAGGTCTGTTGTAGCCAAAGCTGTTGCAAGAGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTTCACGACTGTTTTGTTCAG
GGT
TGTGATGGATCGTTGCTTCTAGACAGCAGTGGAAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGCAGATCAGCTCGTGGGTTTGAAGTTGTTGACGAGATCAAAGCTGCATTGGAG
AATGAATGCCCTAACACTGTTTCTTGCGCTGACGCCCTAACTCTAGCCGCTAGAGACTCCTCTGTTCTT
ACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGACAAGT
GCAAGCTTGAGTGGATCAAATAACAACATTCCTGCACCAAACAACACTTTCAACACAATTCTCTCGAGATTTAACAGCCAAGGTCTCGATCTCACCAATGTCGTTGCTCTCTCCG
GGAGC
CACACAATTGGATTCTCAAGATGTACTAGTTTTAGACAGAGACTTTACAACCAATCCGGAAACGGAAGTCCCGACACAACCTTAGAGCAATCCTACGCTGCTAACTTGCGCCATCGGTGC
CCTAGATCAGGTGGGGACCAGAACCTGTCGGAGCTTGACATCAACAGTGCTGGAAGGTTTGATAACAGCTACTTTAAGAATTTGATCGAGAACATGGGACTGTTGAATTCCGACCAGGTC
TTGTTCTCTAGCAACGACGAATCGAGAGAGCTAGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCGCGGAATCGATGGTCAAGATGGGGAATATCTCTCCCTTGACT
GGTTCAAGTGGTCAAATCAGGAAGAATTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA