Entry information : AruPrx30 (HRP_2021)
Entry ID 12917
Creation 2014-06-12 (Christophe Dunand)
Last sequence changes 2014-06-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx30 (HRP_2021)
Name (synonym) AruPrx30 (HRP_2021)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx30
start..stop
S start..stop
AlyPrx30 637 0 1..331 1..329
CagraPrx41 637 0 4..331 1..326
CrubPrx66 633 0 4..331 1..326
BstrPrx02 628 0 1..331 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37..264 228 N° 2 521..709 189 N° 3 793..955 163 N° 4 1039..1454 416
join(37..264,521..709,793..955,1039..1454)


exon

Literature and cross-references AruPrx30 (HRP_2021)
Literature REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome . BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW58
DNA ref. GenBank:   HE963813.1
Protein sequence: AruPrx30 (HRP_2021)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (302)
PWM (Da):   %s   35672.33 (32683.8) Transmb domain:   %s   i7-26o
PI (pH):   %s   10.08 (9.89) Peptide Signal:   %s   cut: 30 range:30-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTMKRLNVAVAVAVTATVLMGMLGSSEAQLQMNFYAKSCPNAEKIISDHIQKHIPSGPSLAAPLIRMHFHDCFVRGCDGSVLINSTSGNAEKDSAPNLTLRGFGFVERIKTLLEAECPKTVSCADIIALTARDAVVATGGPSWKVPTGRRDGRISNTTEALNNIPPPTSNFTTLQRLFANQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSEYAANLKANKCKSLNDNTTILEMDPGSSKTFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGPEKKFLKAFAKSMEKMGRVKVKTGSAGVIRTRCSVAGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGATGAAGCGATTGAACGTGGCGGTGGCGGTTGCGGTTACAGCGACGGTTCTTATGGGAATGTTAGGATCATCAGAGGCTCAGCTTCAAATGAATTTCTACGCGAAGAGCTGT
CCAAACGCAGAGAAAATAATTTCAGATCATATTCAAAAGCATATCCCTAGTGGTCCTTCTCTTGCAGCTCCTCTCATCAGAATGCACTTCCATGATTGCTTCGTCAGG
GTATTTAATCTC
TAATCTATCTACATATATAGTTGCAAGTGTTTAGATATATTCGACTTTTATGTAACATATGTAGGAAATTAGTATTCACACATCCAGTTCAATAAATGATGGGATAGTCCAGAAGATGTA
CTAATGTATATTTTAAAAAAATGGTAATTTGATAGTGAACATGAGGTAGATCTAGAATATTTGATATTTATTGCATTTTTTAAATATTGACAATGTTTTTGAAAAAAAAAACATAATAAT
CTAGGGATGTGATGGATCGGTGTTGATAAATTCGACATCAGGGAACGCAGAGAAAGATTCAGCACCAAATCTAACACTTAGAGGCTTCGGTTTCGTAGAGAGGATTAAGACTCTTCTTGA
AGCAGAGTGTCCTAAGACTGTTTCTTGCGCCGACATCATCGCACTGACCGCTAGAGACGCAGTTGTTGCCACC
GTAAGTAAACAAATTATAACTTCAAGACTCAAAACATTATTTAATCT
AATTAATCGAAATTATAATCTAATTTTTTTTAATAGGGAGGTCCTTCATGGAAAGTTCCGACAGGAAGAAGAGACGGTAGGATCTCAAATACGACGGAGGCTTTGAACAACATTCCACCG
CCGACGAGTAATTTCACGACGTTACAGCGACTTTTCGCTAATCAAGGCCTTAATCTCAAAGACCTTGTTCTGCTTTCCG
GTAAGTTTAGTAACCGGAAATAACCAGATTGAATTTAACAA
CCTAACGGTGTTTAACTTTTTGTTGTTGTTGTTGTTGTTTAGGAGCTCACACGATCGGTGTCTCGCATTGTTCTTCCATGAATACTCGTCTCTACAACTTCTCGACGACAGTCAAACAAG
ATCCATCTCTGGATAGCGAGTACGCAGCAAATCTAAAGGCTAACAAATGTAAGAGTCTTAACGATAACACCACCATCCTCGAGATGGATCCTGGTAGTAGCAAAACCTTTGATCTCAGTT
ATTATAGGCTTGTCTTGAAGAGGAGAGGTTTGTTTCAGTCTGATTCTGCCTTAACGACAAACTCAGCTACGTTGAAGATGATCAACGACTTGGTCAACGGTCCTGAAAAGAAGTTTTTAA
AGGCTTTCGCTAAGTCAATGGAGAAGATGGGGAGAGTTAAAGTGAAGACGGGCTCAGCCGGTGTGATTAGGACACGTTGTTCTGTTGCCGGAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGATGAAGCGATTGAACGTGGCGGTGGCGGTTGCGGTTACAGCGACGGTTCTTATGGGAATGTTAGGATCATCAGAGGCTCAGCTTCAAATGAATTTCTACGCGAAGAGCTGT
CCAAACGCAGAGAAAATAATTTCAGATCATATTCAAAAGCATATCCCTAGTGGTCCTTCTCTTGCAGCTCCTCTCATCAGAATGCACTTCCATGATTGCTTCGTCAGG
GGATGTGATGGA
TCGGTGTTGATAAATTCGACATCAGGGAACGCAGAGAAAGATTCAGCACCAAATCTAACACTTAGAGGCTTCGGTTTCGTAGAGAGGATTAAGACTCTTCTTGAAGCAGAGTGTCCTAAG
ACTGTTTCTTGCGCCGACATCATCGCACTGACCGCTAGAGACGCAGTTGTTGCCACC
GGAGGTCCTTCATGGAAAGTTCCGACAGGAAGAAGAGACGGTAGGATCTCAAATACGACGGAG
GCTTTGAACAACATTCCACCGCCGACGAGTAATTTCACGACGTTACAGCGACTTTTCGCTAATCAAGGCCTTAATCTCAAAGACCTTGTTCTGCTTTCCG
GAGCTCACACGATCGGTGTC
TCGCATTGTTCTTCCATGAATACTCGTCTCTACAACTTCTCGACGACAGTCAAACAAGATCCATCTCTGGATAGCGAGTACGCAGCAAATCTAAAGGCTAACAAATGTAAGAGTCTTAAC
GATAACACCACCATCCTCGAGATGGATCCTGGTAGTAGCAAAACCTTTGATCTCAGTTATTATAGGCTTGTCTTGAAGAGGAGAGGTTTGTTTCAGTCTGATTCTGCCTTAACGACAAAC
TCAGCTACGTTGAAGATGATCAACGACTTGGTCAACGGTCCTGAAAAGAAGTTTTTAAAGGCTTTCGCTAAGTCAATGGAGAAGATGGGGAGAGTTAAAGTGAAGACGGGCTCAGCCGGT
GTGATTAGGACACGTTGTTCTGTTGCCGGAAGTTAG

Retrieve as FASTA