Entry information : AruPrx12 (HRP_23190)
Entry ID 12918
Creation 2014-06-12 (Christophe Dunand)
Last sequence changes 2014-06-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx12 (HRP_23190)
Name (synonym) AruPrx12 (HRP_23190)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx12
start..stop
S start..stop
AhalPrx49 697 0 1..359 1..358
AlyPrx12 690 0 1..359 1..359
CrubPrx12 686 0 1..359 1..358
ThPrx12 681 0 1..359 23..385
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..267 267 N° 2 1286..1480 195 N° 3 1641..2258 618  
join(1..267,1286..1480,1641..2258)


exon

Literature and cross-references AruPrx12 (HRP_23190)
Literature REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome . BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZWQ4
DNA ref. GenBank:   HE963817.1
Protein sequence: AruPrx12 (HRP_23190)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (328)
PWM (Da):   %s   39282.14 (35897.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.21 (8.21) Peptide Signal:   %s   cut: 32 range:32-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMSYSIRVLTFLMLISLMAVTLNLLSTAEAKKPRRDVPIVKGLSWNFYQRACPKVEKIIKKELKKVFKRDIGLAAAILRIHFHDCFVQGCEASVLLAGSASGPGEQSSIPNLTLRQQAFVVINNLRALVQKQCGQVVSCSDILALAARDSIVLSGGPDYAVPLGRRDSLAFATPETTLANLPPPFANASQLISDFNDRNLNITDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNKSFANSLKRTCPTANSSNTQVNDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFVDKRTRGIVESFAIDQNLFFDHFTVAMIKMGQMSVLTGTQGEIRSNCSARNTASFISVLEEGIVEEALSMI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGAGTTATTCGATACGTGTCCTGACGTTTCTGATGTTGATCTCGTTAATGGCAGTGACACTGAACCTTCTGTCAACGGCGGAAGCAAAGAAGCCGAGGAGAGATGTTCCTATA
GTGAAAGGTCTCTCTTGGAACTTTTACCAGAGAGCATGTCCGAAAGTGGAAAAGATTATCAAAAAAGAACTCAAAAAAGTCTTCAAGAGAGATATTGGTTTAGCCGCAGCCATCCTTCGT
ATACATTTCCATGACTGCTTCGTTCAG
GTTCTATCTTTTTCGTTCCCTAATTTTTTGTATTAAAACCTAATTAAGAACATTTAATTTTATGTTCTTTAAGCCTACTTTAAACGGTTCTAC
GTATGTGATTAACATAATTTTCACTACTTGAAAACTCCTTTTCTTTTAGTATTAGAAACCATATCCACTCATTAGTCATTACTCATCATCATACCCACACAAATAAAATAATAGGATTCG
CGGTGTGTGTCCGGAATGCATGAAAATGAAATTCGTAAAATCAATAAACAAGTTTGACTTTTATATTTTAAAATCCGACCAAAATAGCCTAAAGAAAAAACACAACTCGAAATTCTCACG
AACAAGAAATTAGAGTATTGTCCGCTTCTTACTTTCACTTCTTTTCAAACAAAAGATTTTTTAGTGTAAACAGTAGTTAAGTGACCAAGATATTATTGATCGAAGAGTATTGTACTATTG
TTTAATACTACAGTAGTTGTACATGCGTTTTAGAATAGACTCGAATATAGGACATGTCTCATTAAAACTATTTACCCACTTTCCGTGGATTAGTTGGGCTTCACTTATGGAACGTAAATA
TCTTACATAAATGAATATACATCGAACCAATGGAAGAAATAATAAATATAAGGATATGATAGTATATACAGGTTTATATCTAGATATTTTTTTTAATCAGGAGATGATCCATAGTTTAAA
ATCCGAATCATATGATAAATATATAGCAGTCGAGTAACCCATTCACCAGATATCTATGTAGTTGGATAAAATATCTATGTCTATGGTTTTTCGTTCCAGATTATATATACTTATAAAATC
AACAATATAGACTTTTCTAACTAAATACATATAAAACAAAACAATTACATACTAATCAGATATTTATAGTCTTACTTGCAAGTTGCAACACCTTTTACTGAAGTGTGGCCTATTTTGATC
AGATAAATAGTTTCGGAGAACTAAAAGCTTTTATTATGAGAGTTCATAAAATAAATAATTCTTTTTTATTATTTTAAAAAAACAGGGGTGTGAAGCATCTGTGCTGCTAGCTGGATCAGC
AAGTGGACCAGGAGAACAATCATCTATCCCGAACCTAACACTCCGTCAACAAGCCTTTGTTGTCATCAATAACCTGCGTGCCCTCGTCCAGAAACAGTGTGGCCAAGTCGTCTCTTGCTC
CGACATCCTCGCTCTCGCCGCTCGCGATTCCATCGTCCTT
GTAACCAACTATCTCTCGTCTATAAATCAATCACACAATAATGGGTTTAAATATGGATTATAACACGGCAGTGACACTAA
TATGAACCATTAGCTTATACAACATCGGTTTGTGTCGATATATGCCTTTTTCTAATTAATAAAAAAATGTGTCAATGTAGTCAGGAGGGCCAGACTATGCTGTGCCACTTGGCCGACGTG
ACTCGCTAGCGTTTGCGACCCCGGAAACGACGTTAGCTAACTTACCGCCACCGTTTGCCAACGCAAGCCAGCTCATCAGCGACTTCAACGACAGAAACCTCAACATCACCGACTTAGTAG
CACTTTCCGGTGGTCACACCATCGGAATTGCGCATTGTCCGTCTTTCACCGACCGGCTCTACCCAAACCAAGATCCAACCATGAACAAGTCTTTCGCCAACAGCCTCAAACGCACCTGTC
CCACGGCGAACTCGAGCAACACGCAAGTGAATGACATAAGGAGTCCTGACGTGTTTGACAACAAGTACTATGTTGATCTCATGAACCGACAAGGGCTGTTCACTTCCGACCAGGATCTGT
TCGTTGACAAGAGGACACGTGGCATAGTGGAAAGCTTTGCGATCGACCAGAACTTGTTTTTTGATCATTTCACGGTGGCAATGATTAAGATGGGTCAGATGAGTGTCTTGACGGGGACAC
AAGGGGAGATCCGTTCCAACTGTTCAGCCAGAAACACCGCAAGTTTCATATCCGTTTTGGAAGAAGGCATAGTCGAGGAAGCTCTTTCCATGATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGAGTTATTCGATACGTGTCCTGACGTTTCTGATGTTGATCTCGTTAATGGCAGTGACACTGAACCTTCTGTCAACGGCGGAAGCAAAGAAGCCGAGGAGAGATGTTCCTATA
GTGAAAGGTCTCTCTTGGAACTTTTACCAGAGAGCATGTCCGAAAGTGGAAAAGATTATCAAAAAAGAACTCAAAAAAGTCTTCAAGAGAGATATTGGTTTAGCCGCAGCCATCCTTCGT
ATACATTTCCATGACTGCTTCGTTCAG
GGGTGTGAAGCATCTGTGCTGCTAGCTGGATCAGCAAGTGGACCAGGAGAACAATCATCTATCCCGAACCTAACACTCCGTCAACAAGCCTTT
GTTGTCATCAATAACCTGCGTGCCCTCGTCCAGAAACAGTGTGGCCAAGTCGTCTCTTGCTCCGACATCCTCGCTCTCGCCGCTCGCGATTCCATCGTCCTT
TCAGGAGGGCCAGACTAT
GCTGTGCCACTTGGCCGACGTGACTCGCTAGCGTTTGCGACCCCGGAAACGACGTTAGCTAACTTACCGCCACCGTTTGCCAACGCAAGCCAGCTCATCAGCGACTTCAACGACAGAAAC
CTCAACATCACCGACTTAGTAGCACTTTCCGGTGGTCACACCATCGGAATTGCGCATTGTCCGTCTTTCACCGACCGGCTCTACCCAAACCAAGATCCAACCATGAACAAGTCTTTCGCC
AACAGCCTCAAACGCACCTGTCCCACGGCGAACTCGAGCAACACGCAAGTGAATGACATAAGGAGTCCTGACGTGTTTGACAACAAGTACTATGTTGATCTCATGAACCGACAAGGGCTG
TTCACTTCCGACCAGGATCTGTTCGTTGACAAGAGGACACGTGGCATAGTGGAAAGCTTTGCGATCGACCAGAACTTGTTTTTTGATCATTTCACGGTGGCAATGATTAAGATGGGTCAG
ATGAGTGTCTTGACGGGGACACAAGGGGAGATCCGTTCCAACTGTTCAGCCAGAAACACCGCAAGTTTCATATCCGTTTTGGAAGAAGGCATAGTCGAGGAAGCTCTTTCCATGATCTAA

Retrieve as FASTA