Entry information : AruPrx54 (HRP_4663)
Entry ID 12921
Creation 2014-06-12 (Christophe Dunand)
Last sequence changes 2014-06-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx54 (HRP_4663)
Name (synonym) AruPrx54 (HRP_4663)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx54
start..stop
S start..stop
AtPrx54 660 0 1..358 1..358
AlyPrx54 659 0 1..358 1..357
BstrPrx43 651 0 1..358 1..358
TsPrx54 645 0 1..358 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..234 234 N° 2 359..550 192 N° 3 902..1067 166 N° 4 1159..1643 485
join(1..234,359..550,902..1067,1159..1643)


exon

Literature and cross-references AruPrx54 (HRP_4663)
Literature REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome . BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW09
DNA ref. GenBank:   HE963814.1
Protein sequence: AruPrx54 (HRP_4663)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (327)
PWM (Da):   %s   37060.11 (34027.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.27 (4.33) Peptide Signal:   %s   cut: 32 range:32-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATSSSTTCDGLFIISLLVIASSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSLLLDDTGSIQSEKNAPANANSARGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVLVGRRDGLTANLSGANSSLPSPFEGLNNITSKFLAVGLNTTDVVVLSGAHTFGRGQCVTFNNRLFNFNGTGSPDPTLNSTLLSSLQQICPQNGSGSAITNLDLTTPDAFDSNYYTNLQSNNGLLQSDQELFSNTGSPTIAIVNSFASNQTLFFEAFAQSMIKMGNISPLTGTSGEIRQDCKAVNGQSSATKAEDIQMQSDGPVSLADM

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAACAAGCTCTTCTACTACTTGTGATGGTCTCTTCATCATTAGCCTTCTTGTTATCGCTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCTACGTTTTACTCCGGG
ACGTGCCCTAATGCCTCTGCCATCGTACGCAGCACTATCCAGCAAGCTCTTCAATCCGACCCGAGGATCGGAGCCAGCCTCATCCGCCTTCATTTTCACGACTGTTTTGTTAAT
GTATAA
GTCAATAAGAAGCTCAGAAGATCTTTAAATAAGCTTCTTGGTTTTATTTTATCATAAGGCCTTTTGATTTCTGTTCCACTAATTAACCGCCCTATTTGGCTTCTTTACTTTTGACAAGGG
CTGCGACGGGTCGCTCTTGCTTGACGACACTGGAAGTATCCAGAGCGAGAAGAACGCTCCTGCCAACGCAAACTCAGCTAGAGGATTTAATGTTGTCGACGATATCAAAACTGCCCTCGA
GAATGCTTGTCCCGGCATTGTCTCTTGCTCTGACATTCTAGCTCTTGCCTCAGAGGCTTCCGTGTCTTTG
GTAACAACACTTTCTTCATAAACATATCAAACAAAACAGACACACATATA
TATTTAAACTCACACACATATATAGGGATATTAGTATGGATCAAAAGTCCACGGGGTTCCAATCCCGGCCAAGAATCCCACCGGCTTAATTTTAAAACAAATTTATGTTAAAACGACGTC
ATTTTGGCCAGTTAAAAATATGAGAAAAAAAATAAATTACAGTTGACTAAAAATATTGCATGTGTTTAATCGCACTGATCCTGGCCCTGTGGGCCTTCCCACAGGCTTAATCGCCAATAA
TGAGTTTACATAATTACATTCTTATACACAAATAAAAATATGCATGTTTGATCATCTTCAGGCAGGAGGTCCTTCATGGACTGTGTTAGTAGGAAGAAGAGATGGTCTCACCGCAAACCT
GTCCGGGGCCAATTCGTCGCTTCCCTCTCCCTTCGAAGGCCTTAACAACATCACATCTAAATTTTTAGCTGTCGGGCTAAATACAACCGATGTAGTAGTCTTGTCTG
GTAACTCATCGAC
ATATTTAATTACTTGCGGCTCAATTCAAACAAAACCTTACCTAATGACATATCTCTTGTGTATGTTAAATGTGCATAGGAGCTCATACGTTTGGGCGTGGCCAATGTGTAACCTTCAACA
ATAGACTTTTCAACTTCAACGGAACAGGAAGTCCCGACCCGACTCTGAACTCAACACTTCTCAGCAGTCTTCAACAGATATGTCCTCAAAACGGCAGCGGATCAGCGATCACCAATCTCG
ATCTGACTACACCTGATGCATTTGATAGCAACTACTACACGAACCTTCAGAGTAACAATGGGCTTCTTCAGTCAGACCAAGAACTATTCTCCAACACCGGTTCACCCACCATCGCGATTG
TTAATTCCTTTGCAAGTAACCAAACCCTGTTTTTTGAGGCTTTTGCTCAGTCTATGATCAAGATGGGTAACATTAGTCCCCTGACTGGGACTAGTGGAGAGATTAGACAAGATTGTAAGG
CGGTTAATGGACAGTCATCAGCCACTAAAGCAGAGGACATTCAGATGCAATCTGACGGACCAGTGAGTTTAGCAGATATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAACAAGCTCTTCTACTACTTGTGATGGTCTCTTCATCATTAGCCTTCTTGTTATCGCTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCTACGTTTTACTCCGGG
ACGTGCCCTAATGCCTCTGCCATCGTACGCAGCACTATCCAGCAAGCTCTTCAATCCGACCCGAGGATCGGAGCCAGCCTCATCCGCCTTCATTTTCACGACTGTTTTGTTAAT
GGCTGC
GACGGGTCGCTCTTGCTTGACGACACTGGAAGTATCCAGAGCGAGAAGAACGCTCCTGCCAACGCAAACTCAGCTAGAGGATTTAATGTTGTCGACGATATCAAAACTGCCCTCGAGAAT
GCTTGTCCCGGCATTGTCTCTTGCTCTGACATTCTAGCTCTTGCCTCAGAGGCTTCCGTGTCTTTG
GCAGGAGGTCCTTCATGGACTGTGTTAGTAGGAAGAAGAGATGGTCTCACCGCA
AACCTGTCCGGGGCCAATTCGTCGCTTCCCTCTCCCTTCGAAGGCCTTAACAACATCACATCTAAATTTTTAGCTGTCGGGCTAAATACAACCGATGTAGTAGTCTTGTCTG
GAGCTCAT
ACGTTTGGGCGTGGCCAATGTGTAACCTTCAACAATAGACTTTTCAACTTCAACGGAACAGGAAGTCCCGACCCGACTCTGAACTCAACACTTCTCAGCAGTCTTCAACAGATATGTCCT
CAAAACGGCAGCGGATCAGCGATCACCAATCTCGATCTGACTACACCTGATGCATTTGATAGCAACTACTACACGAACCTTCAGAGTAACAATGGGCTTCTTCAGTCAGACCAAGAACTA
TTCTCCAACACCGGTTCACCCACCATCGCGATTGTTAATTCCTTTGCAAGTAACCAAACCCTGTTTTTTGAGGCTTTTGCTCAGTCTATGATCAAGATGGGTAACATTAGTCCCCTGACT
GGGACTAGTGGAGAGATTAGACAAGATTGTAAGGCGGTTAATGGACAGTCATCAGCCACTAAAGCAGAGGACATTCAGATGCAATCTGACGGACCAGTGAGTTTAGCAGATATGTGA

Retrieve as FASTA