Entry information : TaPrx20-1B (Prx108)
Entry ID 12925
Creation 2014-06-18 (Christophe Dunand)
Last sequence changes 2014-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-18 (Christophe Dunand)
Peroxidase information: TaPrx20-1B (Prx108)
Name (synonym) TaPrx20-1B (Prx108)
Class Class III peroxidase    [Orthogroup: Prx059]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Triticum
Organism Triticum aestivum (bread wheat)    [TaxId: 4565 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TaPrx20-1B
start..stop
S start..stop
AvePrx108 640 0 1..313 1..313
TmPrx04 631 0 1..313 1..313
TaPrx20-1A 589 0 1..312 1..312
HvPrx29 559 0 21..313 21..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..255 255 N° 2 387..563 177 N° 3 656..1300 645  
join(1..255,387..563,656..1300)


exon

Literature and cross-references TaPrx20-1B (Prx108)
Literature Analysis of class III peroxidase genes expressed in roots of resistant and susceptible wheat lines infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009)
DNA ref. GenBank:   EU595582.1
Protein sequence: TaPrx20-1B (Prx108)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (293)
PWM (Da):   %s   32832.11 (30973.1)  
PI (pH):   %s   6.49 (6.49) Peptide Signal:   %s   cut: 21 range:21-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSLSAVLLLCLAVAASAQLSPTFYDTTCPNALATIKSAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQNAFPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTNANEAVANSDLPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYNETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGLLHSDQVLFTGTGGGTDNTVNNFASNPAAFSSAFASAMVKMGNLSPLTGSQGQVRLSCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCGTCTCTATCAGCCGTGTTGCTCTTGTGCCTGGCCGTGGCGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGACGTGCCCGAACGCTCTGGCGACCATCAAGTCC
GCCGTGACGGCCGCCGTGAACAAGGAGAACCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAAGTAAGCTCTTCAAATACATAGCCTGATAGTCGGCACGTT
CCCTGTTTTCATTCC
GGTTTTGTTTGTTAAACACTAGGGTCCATAGTTATCCATGCATGCTTCCTGACTATGCTGCTTAACTACATGTGCAGGGTTGTGACGCGTCTGTTCTGCTGTCTG
GCATGGAACAAAACGCTTTCCCGAACGTGATGTCGCTGCGAGGCTTCGAAGTCATCGACAGCATCAAGGCAAAGCTCGAGACCATGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCA
CCGTCGCTGCCCGCGACTCTGTCGTCGCCGTAAGACCTCCAACCTGTGTCACGTCATGATCACCACCAAGTAGACCGGCTAAT
TTGCTCACCCTGGATATTTGTTTCGTCCTCTGGTACA
GTTAGGAGGGCCTTCGTGGACGGTTCCTCTTGGAAGGAGGGACTCCACCAATGCAAACGAAGCCGTGGCGAACTCTGACCTACCTCCCCCATTCTTTGACCTCGTTAACCTCACCCAATC
CTTCGGCGACAAAGGCTTCACCGTGACCGACATGGTCGCCCTCTCGGGCGCCCACACCATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGACTCTACAACGAGACCAACATCAACTC
CGGCTTCGCGACGTCGCTCAAGGCCAACTGCCCCCAGCCGACCGGCTCCGGCGACCGCAACCTGGCCAATCTGGACGTGTCGACCCCGTACTCCTTCGACAACGCCTACTACAGCAACCT
CAAGTCCCAGAAGGGTCTCCTGCACTCCGACCAGGTGCTCTTCACCGGCACCGGCGGCGGCACCGACAACACGGTCAACAACTTCGCAAGCAACCCAGCGGCGTTCAGCAGCGCCTTCGC
CTCAGCCATGGTGAAGATGGGGAACCTCAGCCCATTGACTGGCTCTCAGGGGCAGGTCAGGCTCAGCTGCTCAAAGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCGTCTCTATCAGCCGTGTTGCTCTTGTGCCTGGCCGTGGCGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGACGTGCCCGAACGCTCTGGCGACCATCAAGTCC
GCCGTGACGGCCGCCGTGAACAAGGAGAACCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAAGTAAGCTCTTCAAATACATAGCCTGATAGTCGGCACGTT
CCCTGTTTTCATTCC
GTGATGTCGCTGCGAGGCTTCGAAGTCATCGACAGCATCAAGGCAAAGCTCGAGACCATGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCGTCGCTGCC
CGCGACTCTGTCGTCGCCGTAAGACCTCCAACCTGTGTCACGTCATGATCACCACCAAGTAGACCGGCTAAT
AACGAAGCCGTGGCGAACTCTGACCTACCTCCCCCATTCTTTGACCTC
GTTAACCTCACCCAATCCTTCGGCGACAAAGGCTTCACCGTGACCGACATGGTCGCCCTCTCGGGCGCCCACACCATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGACTCTACAAC
GAGACCAACATCAACTCCGGCTTCGCGACGTCGCTCAAGGCCAACTGCCCCCAGCCGACCGGCTCCGGCGACCGCAACCTGGCCAATCTGGACGTGTCGACCCCGTACTCCTTCGACAAC
GCCTACTACAGCAACCTCAAGTCCCAGAAGGGTCTCCTGCACTCCGACCAGGTGCTCTTCACCGGCACCGGCGGCGGCACCGACAACACGGTCAACAACTTCGCAAGCAACCCAGCGGCG
TTCAGCAGCGCCTTCGCCTCAGCCATGGTGAAGATGGGGAACCTCAGCCCATTGACTGGCTCTCAGGGGCAGGTCAGGCTCAGCTGCTCAAAGGTGAATTAA

Retrieve as FASTA