Entry information : GbPrx09(Ginbil_Gb_27550)
Entry ID 12982
Creation 2014-12-02 (Christophe Dunand)
Last sequence changes 2018-01-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-11-23 (Christophe Dunand)
Peroxidase information: GbPrx09(Ginbil_Gb_27550)
Name GbPrx09(Ginbil_Gb_27550)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Ginkgoopsida Ginkgoaceae Ginkgo
Organism Ginkgo biloba    [TaxId: 3311 ]
Cellular localisation N/D
Tissue types Leaves
Stems
Inducers Lignification
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value GbPrx09
start..stop
S start..stop
PabPrx125 499 2e-180 3..316 6..318
PtaPrx43 499 2e-180 1..316 1..318
PtaPrx50 499 4e-180 2..316 3..323
PabPrx18 498 4e-180 10..316 2..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..207 207 N° 2 327..518 192 N° 3 648..813 166 N° 4 933..1318 386
join(1..207,327..518,648..813,933..1318)


exon

Literature and cross-references GbPrx09(Ginbil_Gb_27550)
Literature Novo-Uzal,E., Gutierrez,J., Martinez-Cortes,T. and Pomar,F. Molecular cloning of two novel peroxidases and their response to salt stress and salicylic acid in the living fossil Ginkgo biloba. Ann. Bot. 114 (5), 923-936 (2014)
DNA ref. GenBank:   JX444052.1
Protein sequence: GbPrx09(Ginbil_Gb_27550)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33690.79 (31208.6) Transmb domain:   %s   i7-29o (i7-29o)
PI (pH):   %s   8.96 (8.92) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMRTFACISVVALFMTSAYGQLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSSTLTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPSWTVPLGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSFRAHIYNDTNIDTTYANSLKAKCPRTGSDNNISPLDVVTPTSFDNNYFKNLRAKKGLLHSDQELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRKNCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and RNA seq (gba_locus_7381_iso_1_len_1266_ver_2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATGAGAACATTTGCTTGCATTAGCGTTGTAGCGTTGTTTATGACCTCTGCCTATGGGCAGCTTAGCCCAACATTTTATGCCAAGTCGTGTCCGAATGTTTTGTCCACAGTT
AAATCCGCAGTTAAGCAAGCGGTGGCAAAAGAGGCTCGGATGGGCGCCTCGTTGCTCCGTCTTCACTTCCACGACTGTTTTGTTAAT
GTACGTCTTTTCCTTATTGTAATTATACTATTT
GTTTTCTTTTTCTGTATGCGTTTATATATATATATATATACACACACACAGAGTGAATATATATTGAGAATATATTAGTATTGCAGGGCTGCGATGGGTCTATACTGCTGGACGACTCCT
CGACTTTAACAGGCGAGAAGACTGCAGTTCCGAATGCCAATTCCGCAAGAGGTTTCGACGTGATAGACAACATTAAGTCTCAGGTGGAGGCTGTTTGTAGCGGAGTTGTCTCTTGTGCTG
ACATTTTGACCATCGCAGCTCGTGATTCAGTAGTAGAA
GTAAGCAATTTTTTTTTTCGTATTTATCAGAACTATAGCTAATTTAACAAAGTTATATGTATATCTTCCATACAAACTCTGC
GAATGAATAGAATTGTTCTAATGGTGGTATATACATTCTTGATGTAGTTGGGAGGTCCATCATGGACGGTTCCTCTGGGAAGAAGAGACTCAAGAACTGCAAGTCTGAGCGGTGCAAACA
ACAACATTCCACCCCCCACTTCGAGTCTCGCCAATCTCATGTCTAAATTCCAAGCTCAGGGCCTCTCTACTAAGGATATGGTTGCACTTGCAG
GTAAATAAATAAATATATTTAAATCAA
TCAAAACAAAAATTTGGTGATATTTCCTTTTAAATTGTAGCTAATAGATAATAATAATAATTAGAATTGGCTGTTTATTATTTTTGTTTCAGGGGGTCATACCATTGGGCAAGCGCGTTG
CACAAGCTTCAGAGCACATATATACAATGACACCAACATAGACACCACTTATGCTAACTCATTGAAAGCAAAGTGCCCAAGAACTGGAAGCGACAACAATATTTCGCCCTTGGATGTCGT
TACACCGACTTCTTTTGACAATAATTATTTCAAAAATCTGCGAGCCAAAAAAGGACTTCTGCACTCTGATCAGGAACTCTTCAATGGCGGATCCACCGACTCTCAGGTCACTTCCTACGT
TACCAGTCCCATTACTTTCCGCAACGACTTTGCTACGTCAATGGTGAAAATGGGAAATATAAAGCCTCTTACTGGTACCAATGGAGAGATCCGAAAGAACTGCAGGAAACCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATGAGAACATTTGCTTGCATTAGCGTTGTAGCGTTGTTTATGACCTCTGCCTATGGGCAGCTTAGCCCAACATTTTATGCCAAGTCGTGTCCGAATGTTTTGTCCACAGTT
AAATCCGCAGTTAAGCAAGCGGTGGCAAAAGAGGCTCGGATGGGCGCCTCGTTGCTCCGTCTTCACTTCCACGACTGTTTTGTTAAT
GGCTGCGATGGGTCTATACTGCTGGACGACTCC
TCGACTTTAACAGGCGAGAAGACTGCAGTTCCGAATGCCAATTCCGCAAGAGGTTTCGACGTGATAGACAACATTAAGTCTCAGGTGGAGGCTGTTTGTAGCGGAGTTGTCTCTTGTGCT
GACATTTTGACCATCGCAGCTCGTGATTCAGTAGTAGAA
TTGGGAGGTCCATCATGGACGGTTCCTCTGGGAAGAAGAGACTCAAGAACTGCAAGTCTGAGCGGTGCAAACAACAACATT
CCACCCCCCACTTCGAGTCTCGCCAATCTCATGTCTAAATTCCAAGCTCAGGGCCTCTCTACTAAGGATATGGTTGCACTTGCAG
GGGGTCATACCATTGGGCAAGCGCGTTGCACAAGC
TTCAGAGCACATATATACAATGACACCAACATAGACACCACTTATGCTAACTCATTGAAAGCAAAGTGCCCAAGAACTGGAAGCGACAACAATATTTCGCCCTTGGATGTCGTTACACCG
ACTTCTTTTGACAATAATTATTTCAAAAATCTGCGAGCCAAAAAAGGACTTCTGCACTCTGATCAGGAACTCTTCAATGGCGGATCCACCGACTCTCAGGTCACTTCCTACGTTACCAGT
CCCATTACTTTCCGCAACGACTTTGCTACGTCAATGGTGAAAATGGGAAATATAAAGCCTCTTACTGGTACCAATGGAGAGATCCGAAAGAACTGCAGGAAACCCAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATATTAGCG AAGACCTCGA GAGGCCATAT TATTATTATA CCTGCAATAT TTTTGCAGTG CGTATACTCA GAAATGGCTT CCATGAGAAC ATTTGCTTGC ATTAGCGTTG TAGCGTTGTT  TATGACCTCT GCCTATGGGC AGCTTAGCCC AACATTTTAT GCCAAGTCGT GTCCGAATGT TTTGTCCACA GTTAAATCCG CAGTTAAGCA AGCGGTGGCA AAAGAGGCTC GGATGGGCGC  CTCGTTGCTC CGTCTTCACT TCCACGACTG TTTTGTTAAT GGCTGCGATG GGTCTATACT GCTGGACGAC TCCTCGACTT TAACAGGCGA GAAGACTGCA GTTCCGAATG CCAATTCCGC  AAGAGGTTTC GACGTGATAG ACAACATTAA GTCTCAGGTG GAGGCTGTTT GTAGCGGAGT TGTCTCTTGT GCTGACATTT TGACCATCGC AGCTCGTGAT TCAGTAGTAG AATTGGGAGG  TCCATCATGG ACGGTTCCTC TGGGAAGAAG AGACTCAAGA ACTGCAAGTC TGAGCGGTGC AAACAACAAC ATTCCACCCC CCACTTCGAG TCTCGCCAAT CTCATGTCTA AATTCCAAGC  TCAGGGCCTC TCTACTAAGG ATATGGTTGC ACTTGCAGGG GGTCATACCA TTGGGCAAGC GCGTTGCACA AGCTTCAGAG CACATATATA CAATGACACC AACATAGACA CCACTTATGC  TAACTCATTG AAAGCAAAGT GCCCAAGAAC TGGAAGCGAC AACAATATTT CGCCCTTGGA TGTCGTTACA CCGACTTCTT TTGACAATAA TTATTTCAAA AATCTGCGAG CCAAAAAAGG  ACTTCTGCAC TCTGATCAGG AACTCTTCAA TGGCGGATCC ACCGACTCTC AGGTCACTTC CTACGTTACC AGTCCCATTA CTTTCCGCAA CGACTTTGCT ACGTCAATGG TGAAAATGGG  AAATATAAAG CCTCTTACTG GTACCAATGG AGAGATCCGA AAGAACTGCA GGAAACCCAA CTAAATATAA TATTATAACC CACCTCTATT TGCTGCTTTG TACCATTGAA TTTATGTGAG  TATTTGTTAT AATAAATAGA GTTGCTTGAT GTCACCAATT GATTAGATGC CTAATAAATC AAGTTGACTC TCCAGGAAGG AAGGTTAGTT ATACGCATGT AGCTTCCGAG TTTTGGAATT 
TCAGTTCCTT TTAGTTGATA TTATGTATCC ATTCGGCAAA GAAAGCCGCC TTATATTCAT AATACCAACC AAGGGATTAT TAT 

Retrieve as FASTA