Entry information : AalpPrx09 (AALP_AA7G239300)
Entry ID 13073
Creation 2014-12-11 (Harold Duruflé)
Last sequence changes 2015-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-01-30 (Christophe Dunand)
Peroxidase information: AalpPrx09 (AALP_AA7G239300)
Name (synonym) AalpPrx09 (AALP_AA7G239300)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabis
Organism Arabis alpina    [TaxId: 50452 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalpPrx09
start..stop
S start..stop
AtPrx49 630 0 1..331 1..331
BrPrx49-2Aa_other 628 0 1..331 1..331
AruPrx49-2 627 0 1..331 1..331
AruPrx49-1 626 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26330366..26330590 225 N° 2 26330091..26330282 192 N° 3 26329847..26330012 166 N° 4 26329331..26329743 413
complement(join(26329331..26329743,26329847..26330012,26330091..26330282,2633036 6..26330590))


exon

Literature and cross-references AalpPrx09 (AALP_AA7G239300)
Literature Lobréaux S1, Manel S, Melodelima C. Development of an Arabis alpina genomic contig sequence data set and application to single nucleotide polymorphisms discovery. Mol Ecol Resour, doi: 10.1111/1755-0998.12189.


DNA ref. GenBank:   CM002875.1 (26330590..26329331)
Protein sequence: AalpPrx09 (AALP_AA7G239300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36082.19 (33631.9)  
PI (pH):   %s   8.61 (8.73) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLTSFLLLISLLCFVPLCLCDKSYGGKLFPGYYAHSCPQAGEIVRSVVAKAVAKETRMAASLVRLHFHDCFVQGCDGSLLLDTSGRIKSEKSSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVLSGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQRCPRSGGDQILSVLDIISAARFDNSYFKNLIENKGLLNSDQVLFSSNEKSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSNGEIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns)
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTCTCTC TGATACATAT TGTTTGTGTT TCTTACATTA TTTCAGAATA CAACCAAGGT AGTGAAGGAG GATCAGCGAA AGGGTGGGCT ATATTCGGAG TTTTTTCATG CGTGTAACGA  AAATCTCTCT CTCTCAAAAT CACAAATGCT TTGTAACAGG AGAATTAGCT CAACTAATTG TTTACTGGTG TGTTGCTTCT GTTCAGATCC CTCGTTGCAT GTACACTTTT CTGCTGTGGA  GGATTTATCT ACAAAACAAG AGTAGAACGC GTGGTAACCT TCAATCCTTC TACTCCATTC TTAATTCTCT AATTCTTCCG TCACGCTATA TATACACAAA ATCACTGATA TGTTCGTATG  GGCGCAGCGT GGAATTGATG CATTGCCAGG GATGTCACTT CTATCAGGCT TACTAGAAAC TGTATGTATT CATTTATGCG GAATCAATGA GAAAGCTCGC TGTTGGTCTT TAGTGTTTAG  TGTATGGATC TCTCAAGAGA CAAGTTCTAT GTAAATCTAA TGGCTATGGT CTATGTAAAC AGGTGAGTGG AAGTGGACAA AGCTACTCAA GAACTGAAGA AATCAACAAT GCTTTTGCCA  ATGAAGTCTC ATGGGACCGC TCCTCAGCGT CTTCTACTCA AGCACCAACA CAGAGACCAA GTGAAAGAAC ATATGGTGCA ATCTAAACTG CTAATTTCAT GCTGTTGAAC GGCATTTTTC  GGGTTTTACT TTTTGTTTTC AATCTTCATG TTTTAGTTTC TAGAATGAAG GAAATATGTG TAAGAGTCAA AAAGTTTGAT AGATTCAACT AGAGATTGCT TTTACCTGCA GATTCATATG  TTAGTATACA AGAAGACAAA TAAACTTTCT TTCTTTGCAT TGTATTGGTT AACAAGAAGA AGAGTGTGTT CACAAGTCAA CAAAGATTGA AACTTTGAGA TAACAAAAAT TTGTCAAAAG  AGAGTGGTTA GAATCTCTTC CTACTCTCTT CTCTTTCTCA CTATATACAC AAAGACTTGG ACTTTGTCTT TGTCTTTGCA AACATAGTAA TTTAATGGAT ATTATTAACC AAAGTCCTTT  GTAAAACTAA AAATAGTATT TCTTTTGACT TCTTCTTTTA GATTTTAGTT AAACCTAGGC ATTATATTGG TTACTTTGTT GAATACTATC TGATTATTCT GTTCATACTT TGGTTTCCTC  TCTTTTTATT TTCCTTTGCT TCAAATAAAA GAAAGGATCA GTAAACTTAA TCTCTTGATA TATTTGGGAT CATAAAATCT CAATATTTTC TAGATTGAAC CAAGATTAAG ACTTCCATAT  GATTATGATC TTGAGTATTA AATATCTTAA GACATCATTG TGCCTTCTAT GTTAGTGACT AGCATTCTTT GTTGTGTAAT CGATTTATGT AATTAGGCTT CATAATCAAA ATTCTAGTTT  TAAACTAATT TCGAATTCTA CGACAAGTGT GCCGCAAATA AAAATTGCTT TCTAGCCTTA ATCAAGAAGT CGAAATCAAT GAATATGGTG AAGCAAGAAA ATTCGAATAT TCATTCCTAG  AAGAAGAAAA AAGTTAATAG TCATTAAATT ATTGTTATGA GTTGTTAATA TGGATAAAGA TCTTCTTCAA TTATATTAAA AAGTAAAAAA CTCAAAGCTT GCTTAGCTTT TCCCCCTCCA  AGTTTCAAAA GTCAAATTAA TTATAAAATA ATTAAACCTC AAAAAGAAGG TTAATTAGTC AAAATTAGCA TGCAATGTTT GGTACCAAAC CCAAGCTTTA GTCTCTTTTC ACCTTATTTT  TTTCAGTAAA TTGACAATAT GTTTTTGCAT TTCATTTTAT TGTTAACTTA ATCCCCAATT TAGCTAATAC CAACTCCATT TCCTCTAGCT TCTTCTACTT CAAACTCACT TCCTATAAAT 
ACCTTCTTCT TCTCCTCTTT CTTCATATCA CTCATCATCT CAAAGTCTTC TCTTTGCTTC ATCTTCTTGA AAGTAATTCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACTAGCTTTCTTCTTCTTATTTCTCTCCTTTGCTTTGTCCCTCTTTGTCTCTGCGACAAGAGCTATGGAGGTAAACTCTTCCCGGGTTATTACGCCCATTCTTGCCCT
CAAGCCGGAGAAATCGTGAGATCAGTTGTAGCTAAAGCTGTTGCTAAAGAGACTCGTATGGCTGCTTCTTTAGTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTGGTTACTTTCT
CATTACGTTTCATTGTTCTTTGTTTATTAAGTTAGTTACTTGTTAACCAAGTTACCTTTGAAATGTAGGGTTGTGATGGCTCTTTGCTTCTAGACACCAGTGGGAGAATAAAGAGTGAGA
AAAGCTCGAACCCTAACAGCAAATCGGCTCGTGGATTCGACGTAGTTGATCAGATCAAAGCCGAGTTGGAGAAACAGTGCCCTGGAACTGTCTCTTGTGCTGATGTTCTAACCCTAGCTG
CTAGAGATTCCTCTGTTCTT
GTAAGTCCCCTACATAATATCTGCTTTCTCGAAGCGAACTTAAAAATATTAGCTAATTTGGTTTGGTTTTTGGTTTAGTCTGGTGGACCAAGCTGGGTCG
TTCCATTGGGAAGAAGAGATTCGAGAAGTGCTAGCTTGAGTGGTTCAAACAACAACATCCCTGCCCCAAACAACACTTTCCAGACCATTCTCACAAAGTTTAACCGTCAAGGACTCGATG
TCACCGATCTTGTCGCTCTCTCTG
GTAAGATTCTTTCACTTAGTCCCAGTTGCTTCACAGGCACGAAACCCAATTATAGAAACCCTACTATTTTACTTGCTTCTCAAGACACAATATTGT
TTCTCAGGGAGTCACACCATTGGATTCTCGAGATGCACGAGTTTCAGACAGAGGCTATACAATCAATCCGGAAACGGTAGTCCAGACATGACATTGGAACAATCCTTTGCTGCTAACTTG
CGCCAAAGGTGTCCAAGATCCGGTGGAGACCAGATTCTCTCAGTGCTAGACATCATCAGTGCCGCGAGATTCGACAACAGCTACTTCAAGAACTTGATAGAGAACAAAGGTTTGTTGAAT
TCGGACCAGGTTTTGTTCAGCAGCAACGAGAAATCGAGAGAGCTTGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTTTTCGAGCAGTTTGCGGAATCGATGATCAAGATGGGAAATATC
TCTCCCTTGACGGGTTCAAATGGAGAAATCAGGAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCACTAGCTTTCTTCTTCTTATTTCTCTCCTTTGCTTTGTCCCTCTTTGTCTCTGCGACAAGAGCTATGGAGGTAAACTCTTCCCGGGTTATTACGCCCATTCTTGCCCT
CAAGCCGGAGAAATCGTGAGATCAGTTGTAGCTAAAGCTGTTGCTAAAGAGACTCGTATGGCTGCTTCTTTAGTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCT
TTGCTTCTAGACACCAGTGGGAGAATAAAGAGTGAGAAAAGCTCGAACCCTAACAGCAAATCGGCTCGTGGATTCGACGTAGTTGATCAGATCAAAGCCGAGTTGGAGAAACAGTGCCCT
GGAACTGTCTCTTGTGCTGATGTTCTAACCCTAGCTGCTAGAGATTCCTCTGTTCTT
TCTGGTGGACCAAGCTGGGTCGTTCCATTGGGAAGAAGAGATTCGAGAAGTGCTAGCTTGAGT
GGTTCAAACAACAACATCCCTGCCCCAAACAACACTTTCCAGACCATTCTCACAAAGTTTAACCGTCAAGGACTCGATGTCACCGATCTTGTCGCTCTCTCTG
GGAGTCACACCATTGGA
TTCTCGAGATGCACGAGTTTCAGACAGAGGCTATACAATCAATCCGGAAACGGTAGTCCAGACATGACATTGGAACAATCCTTTGCTGCTAACTTGCGCCAAAGGTGTCCAAGATCCGGT
GGAGACCAGATTCTCTCAGTGCTAGACATCATCAGTGCCGCGAGATTCGACAACAGCTACTTCAAGAACTTGATAGAGAACAAAGGTTTGTTGAATTCGGACCAGGTTTTGTTCAGCAGC
AACGAGAAATCGAGAGAGCTTGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTTTTCGAGCAGTTTGCGGAATCGATGATCAAGATGGGAAATATCTCTCCCTTGACGGGTTCAAATGGA
GAAATCAGGAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA