Entry information : AalpPrx25 (AALP_AA4G198700)
Entry ID 13075
Creation 2015-01-30 (Christophe Dunand)
Last sequence changes 2015-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-01-30 (Christophe Dunand)
Peroxidase information: AalpPrx25 (AALP_AA4G198700)
Name (synonym) AalpPrx25 (AALP_AA4G198700)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabis
Organism Arabis alpina    [TaxId: 50452 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalpPrx25
start..stop
S start..stop
TsPrx25 620 0 1..325 1..326
BrPrx25-1Aa_other 616 0 1..325 1..326
BrPrx25-1Ab_other 611 0 1..325 1..326
AtPrx25 603 0 1..325 14..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18769645..18769857 213 N° 2 18769371..18769550 180 N° 3 18769128..18769290 163 N° 4 18767975..18768396 422
complement(join(18767975..18768396,18769128..18769290,18769371..18769550,1876964 5..18769857))


exon

Literature and cross-references AalpPrx25 (AALP_AA4G198700)
DNA ref. GenBank:   CM002872.1 (18769857..18767975)
Protein sequence: AalpPrx25 (AALP_AA4G198700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35129.77 (32581.4)  
PI (pH):   %s   6.66 (6.66) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVLGNYLYVMIIVLVLVSEVRSQSLKNGYYSTSCPKAESIVRSTVESHFDSDPSISPGLLRLHFHDCFVQGCDGSVLIKGKSAEQASPANGGLRGMEVIDDAKARLESECPGVVSCADILALAARDAVDLSSGPSWKVPTGRKDGRISLASEASNLPSPLDSVAVQKQKFEAKGLDTHDLVTLLGAHTIGQTDCLFFRYRLYNFTVTGNSDPTISPSFLTQLKTLCPPNGDGSKRVALDIGSPSKFDTSFFKNLRDGNAILESDQRLWSDSETNDVVKKYASTIRSLFGFRFDNEFGKAMVKMSSIDVKTDVDGEVRKVCSKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chomo 4, 3 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACCCCTAGT TTGATCCATT GATTGACCAA CGGTCAATTA ATGTTTTTAC ATTAGGAGTT ATGCGGGTTT AATTTATAGA ATACAATTTG AAAAAAATTA ATTATGCAGA TTAATAGAAA  CAAACTTACG AGAAATCTTC AGCGTAGAAT AAGTAAAATC GTTCGTTGTA ATTTTACTCC TTAAAAATAA AAGGGTGTAT ATGAAGAGCA TGGAAAATAT ATTGTATGTT GTAAAGTGGT  TTTGTCTGTA ATAAAATTGT CTTTTTAATA ATTTTTTAAT TTATAATAAA TTCAGACGTT AAAAAAAAAA ATCATGTGAA TTGCTATAAA CGCACAATAT AATATTTATT AAAACATGTA  TTTACGAATG TTTCATAGAT GTAAGAAAAT AAATTGTGAA AATGTAACAG CTACTACTTC AGATATATTA TTTCATAACT AGTGCAGGAT ATGAACACTA CTACTTCAGA TATGAATAGA  TAATGGGAAC ACTACACACG GGGTTTCTTT TCCAAGAATA TTTACTAGAT CAATTGTTAA ATATACATAC AAGTATCACT CACCACGTTG ATCCCAGCTT CACACGTTTC TAAGATCTAT  CCATGATCTA GAAACCACTC TCTACCCCTT AGCCTTTGAT TCTAGGTTTC TTATATACCC TAACCCTTTA CTAAGAAATA AGCTCCTAAG TGTTCAACCT TGCAACAATG CACGAACACC  TCTATTTATA CAAAATAGGT AAACGACTAA ACCTAGCCTT GCTCTCTACT CCTCGAAGAT CTTCATATTT TTTTGGAGAT ATTCTCTCTT GCCTTATTTC CTTATTTTTC TCAAGTGATA  AGACAAGTCT TCAAGCCAAA CTTGATCCTT ACGAAAGACC TCCTCTAGCT CTGCTACATC ATCTTGAGCT CGTCTCATTT TGGTTGAAAC GTCCAGTCCA GCCCATCTCC TCAAGCCCGT  GTCGCACAAG TCTTGAGTAA TCTGCTCTGC ATCACTTCCT GAAGTATTTC GTACAGCTTC AGGAAGTTGC TTCAGATACT TGCATCTTCA AAAGAATCAC AAACATTTGA TTAATTCACA  TGCACGTGTT TTTAATAAGT TACAAACTAG CATATTTTAT ATTCTTGCAT AAAAAAACTA AATCGATAAT CCGCCATCTC CTCCACTAGC CACACTACAA CCATCTCAGT TGCTACCACT  ACCACCACCA CCGTCACTAC ATTAATAACT CATGGACCAA ATTCAATCAA ATTAATAAAT ACTATCTAGC ATGCATTCTA TGTTGAAATC ATGAAGATGT GTGTAATAGC ACCAAACAAG  AGAAGCTAAA CGAAATGAGA TTTGAGAAAA AATGATTATG ATTTTTTATC CTTTTCACTT TTATATGGAG TGCTTCGTTG TTCTTCTACG TTAGATCTCA ATTTTTCGAT TCGTTTTATG  TAGTAAATGA AAAAAAAATG ATTAATTAGG GTTGAAATGA AACTACAAGA GAGATGTGAA CGGGGAGAAA ATAGTGACGG CTTATGTCAG AATCAAGTTG TGAACACGTT TATAGATTTC  ATGGATTATA CTAAAGTTTG AGGAAGTGAT CAAAGAAACT TTAAAGGTAA AGCAAACGAA TCATATATAT TCTGAAAGGA CGTTTTTGTT ATTAAAAAAA GCTGATTTTC AACGTACGTT  AGCACGATCG AAACTCCTAG ATATGATAAC TTTCCAAATA AAATTATATG AAACTATTAT AATCAAAACC CATTATTTCA TCATAGTGGC AACCAAGTGT ATATACCAAC ATAAACAAGT  AAACTAAAGG AAAAAAGAAG GCACTATATG TCCCCAGTCC CCACACGGTT CCATTGAGAC AAAGGCATGC ATATGTATGT GTGTGACTAT ATATATAAAT ATACGTTAGT TCTTGAACAT 
CATTACATGT AAACTGATCA CACACACATT TAGCACACAA AAAAAACTGA TCACAAACAC ACAAAAAAAG AGTTAGAAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTTAGGTAATTACTTGTATGTAATGATAATAGTGTTGGTGTTGGTGAGTGAAGTAAGAAGTCAGTCGTTAAAAAATGGTTACTATTCAACTTCATGTCCAAAAGCTGAGTCC
ATAGTAAGATCAACCGTTGAATCTCACTTTGATTCTGATCCATCTATTTCTCCTGGCTTGCTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GTTCCTCCAGTTCTTCTAAAATCTTTA
GAATCCCCTTTTATCAACTAATACACAAGTTCATTGATTGTTGAATATATTTTGACCTTTTTAATAGGGTTGTGATGGATCGGTTTTAATCAAAGGGAAATCTGCGGAACAAGCCTCTCC
AGCGAATGGCGGTTTACGAGGGATGGAAGTGATCGATGATGCAAAAGCCCGGCTTGAGTCGGAGTGTCCAGGAGTTGTGTCATGTGCGGATATACTTGCACTAGCTGCTCGTGACGCTGT
TGACTTG
GTATGCAACTTTACTAACCTAACTGATTAGGGTTCACTTATTTCTTTTGGTAGGTTATTATTGATTAAGTATGTAAACAGAGTTCTGGACCAAGCTGGAAAGTTCCAACGGGA
AGAAAAGATGGGAGAATCTCTTTGGCATCGGAAGCATCGAATCTACCATCTCCACTTGATTCTGTTGCTGTTCAAAAGCAAAAATTTGAAGCTAAAGGCTTAGATACTCATGATCTCGTT
ACTCTACTCG
GTATTTTTATTCATCTCTCTATCTTGTTTTTTAAAACGTATATTTATTCATCTCTCTATCTTGTTTAAAAAACATATATTTATGTTCTACATATGTTTCTTTTCAAAAGA
TTTTAACAAAAAAAATATGAGTGATTATTTGTTTATCGATGTTTTAACCATAAACTGCGAATCATTGGACTTTAACTCGGATGCATAACGCGTTATCCATTAGTTGAGCCACATGATTTG
GTACAGGCTATGAATCCAATCACTCTTTTGAAAATATGTTAAACCTCTATAAGTAACATGTTTAAAAGGAATATATTTAGAGCTATATTTTCGAAAATTGAAAGTACGGTATGCACAAAT
TAAATGACACGCCAACATGTAAAAAGTTCAAGTACGTAAAAGATGAAGTGAGCCTTCTCTCGTTTTAATGATATTTTTCTTTTGGAATTTGAGCAAAGGCTATTTACACAACTACTCGTT
GATTTGAGATTCAAATTTAAAAACTCCTTTTAGTGGCCACTTGCGTACTAAACCTTGAAGTCAAATCGATCAAGAAAATTATCAACCCGTTAGATTTTTAGGATCATAATTTTGTGCACT
TATGTAGATCGAGTAATTAATTACACTTTTAGTTTTTTAATGAACGCGTGCCGCAATTTGTTCATCTATACATCCACTTTTACCTATATAACACATTTAAATAATCATATATCCACTATA
TTTTTGTATATGGACATGCAGGTGCACATACAATAGGACAAACGGATTGTCTCTTCTTCCGTTACCGTCTATACAACTTCACGGTGACCGGAAACTCCGACCCAACCATAAGCCCATCGT
TTCTTACACAACTCAAGACTCTTTGTCCTCCCAATGGAGACGGTTCGAAACGTGTTGCTCTTGATATTGGTAGTCCATCAAAATTTGATACAAGCTTTTTCAAGAATCTACGAGACGGTA
ATGCCATTTTGGAGTCGGACCAAAGGCTTTGGTCGGACTCGGAAACAAATGACGTGGTGAAGAAGTATGCGAGTACTATTAGGAGTTTGTTTGGGTTTAGGTTTGATAATGAGTTTGGTA
AAGCTATGGTTAAGATGAGTTCCATTGATGTAAAGACAGATGTTGATGGTGAGGTTAGGAAAGTTTGTTCCAAGATAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTTAGGTAATTACTTGTATGTAATGATAATAGTGTTGGTGTTGGTGAGTGAAGTAAGAAGTCAGTCGTTAAAAAATGGTTACTATTCAACTTCATGTCCAAAAGCTGAGTCC
ATAGTAAGATCAACCGTTGAATCTCACTTTGATTCTGATCCATCTATTTCTCCTGGCTTGCTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GGTTGTGATGGATCGGTTTTAATCAAA
GGGAAATCTGCGGAACAAGCCTCTCCAGCGAATGGCGGTTTACGAGGGATGGAAGTGATCGATGATGCAAAAGCCCGGCTTGAGTCGGAGTGTCCAGGAGTTGTGTCATGTGCGGATATA
CTTGCACTAGCTGCTCGTGACGCTGTTGACTTG
AGTTCTGGACCAAGCTGGAAAGTTCCAACGGGAAGAAAAGATGGGAGAATCTCTTTGGCATCGGAAGCATCGAATCTACCATCTCCA
CTTGATTCTGTTGCTGTTCAAAAGCAAAAATTTGAAGCTAAAGGCTTAGATACTCATGATCTCGTTACTCTACTCG
GTGCACATACAATAGGACAAACGGATTGTCTCTTCTTCCGTTAC
CGTCTATACAACTTCACGGTGACCGGAAACTCCGACCCAACCATAAGCCCATCGTTTCTTACACAACTCAAGACTCTTTGTCCTCCCAATGGAGACGGTTCGAAACGTGTTGCTCTTGAT
ATTGGTAGTCCATCAAAATTTGATACAAGCTTTTTCAAGAATCTACGAGACGGTAATGCCATTTTGGAGTCGGACCAAAGGCTTTGGTCGGACTCGGAAACAAATGACGTGGTGAAGAAG
TATGCGAGTACTATTAGGAGTTTGTTTGGGTTTAGGTTTGATAATGAGTTTGGTAAAGCTATGGTTAAGATGAGTTCCATTGATGTAAAGACAGATGTTGATGGTGAGGTTAGGAAAGTT
TGTTCCAAGATAAACTAG

Retrieve as FASTA