Entry information : AalpPrx36 (AALP_AA5G133200 / peroxidase72)
Entry ID 13076
Creation 2015-01-30 (Christophe Dunand)
Last sequence changes 2015-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-01-30 (Christophe Dunand)
Peroxidase information: AalpPrx36 (AALP_AA5G133200 / peroxidase72)
Name (synonym) AalpPrx36 (AALP_AA5G133200 / peroxidase72)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabis
Organism Arabis alpina    [TaxId: 50452 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalpPrx36
start..stop
S start..stop
TsPrx36 595 0 1..340 1..340
BrPrx36-1Aa_other 579 0 1..337 1..337
AlyPrx36 576 0 1..338 5..340
CsativPrx36 572 0 1..338 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10995476..10995718 243 N° 2 10995807..10995998 192 N° 3 10996087..10996252 166 N° 4 10996534..10996955 422
join(10995476..10995718,10995807..10995998,10996087..10996252,10996534..10996955 )


exon

Literature and cross-references AalpPrx36 (AALP_AA5G133200 / peroxidase72)
DNA ref. GenBank:   CM002873.1 (10995476..10996955)
Protein sequence: AalpPrx36 (AALP_AA5G133200 / peroxidase72)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (316)
PWM (Da):   %s   37577.27 (35012.9)  
PI (pH):   %s   4.74 (4.82) Peptide Signal:   %s   cut: 25 range:25-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAESMVFIVLAQISLVALFPLCMGNQTNESTTTASLSPQFYDNSCPKAQAIVQSIVVKAYSDDPRMAASLLRLHFHDCFVNGCDGSVLLDNSGTMESEKRSEPNQNSARGFEVIDDIKSTLENECPQTVSCADILALVARDSTVITGGPNWEVYLGRRDARDANLNGSNNNIPSPNSTIQTLVTKFYLHGLDLTDLVALLGSHTIGNSRCTNFRQRLYNHSGNSDIDQTLNQNYASMLQQGCPISGDDQNLFALDYATPTKFDNYYFKNLVSYKGLLSSDEILYTKSKDSMELVKLYAENEEAFFEQFAKSMVKMGNISPLTGNDGEIRRICRRVNHEDV

Retrieve as FASTA  
Remarks Complete sequence from geomic (chromo 5, 3 introns)
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGGCGATTT TACAAAAGCT TCGTAACTTC TTTTGCCGTT TCCGCCGCCG GCTTTTGCCG GTAGTTCGTA CGTTTAGGCA ACATATCACA GAAATTAATC ATGTATTCTT CTATAAATTA  AATGAAGCCA TTTATCACTT ACACTATCAT GATATAATCA CGAGAGTTTC CAAGAAAACT CCCAAGTAAA TAATAGAATC AAATGGCAAA GTCAAATCCC CCTCGTTACC ATGTTTCTCT  ATATGCCACC ATATAAGTAT CATCCTCGAA AACAATATTC TCATAATCTC TCATAAATCC CTAAGGTAGA CTACATAAGA TAGATTCAAG AATTTTCATG ACCTGAGACT CGGACCATGC  AGTTTGAATC ACGTAGTTGC CAAATGGGTC TAAAAGAAGC ATATTGATCT CGTCCAGTAG GCCGTACACA AAACCTAGAG CCGCCTGGAA AATTTATCGG GGTTATAAAA AAAAGAATCA  TCTCCTCGTC TTTACGGTCT TGTATATTTT CAAAAGCTTT TGTATAATAT GTTTTCCATA TTTGTTGCAG GAGAGGTATT TGTAGTTCCT TTTTGATTTC TATGGAACTT ATATGTTAGA  CGCTCATCTT CTAGCTCCAC AACATACTGC ATGTCCTGGT TCTGAAAAAG AATATACTTG TGAGTAAACG AAAGAGGATA TGAGAAAGAA AACGATTGTA AGGTTGTTGG ATGTTTACCC  GTAGAAGTCC TCATAGAGTG TCAACTCATG AGAGATTATC TCAGCAATCA AACAGGCCTT AAGCTGATCA CAATTGATGC CAAGACACTG CCAAAGCATG CCGCAGCCAT ATCGGTCTGT  TGCTATTTGA AAACAGTTTC GAACAACAAC ATTTACAAGA TTCTGTAGAA ACATAATAGA GAAAAGAATA AATGTCAGCT GAAGAATACT TGCAAAGAAG ATCAACACAT GTTTGTAAAT  GATGATTCAG GCCTATCATG GATCATTAAA CTTGTACCAC AAGCAACATA ATTACTGAGG TTCGAACAGC TACAAACATA CTATACAGAT TCTTGAAAAC GTTGAGTTAT ATAGCAAATA  TTGAAGTGAA TAAAACAGAC ATTGCAAACT GAACTGATAG AAGCAACTGA AACATTAAAT TGATTCGTCA ACTTAAAAAG GTAGAAGTAA ATGTTTCGTG AAAAATGTAG AATATGATGC  TAAAAAATAT GAAGTAAAAT TACTTACTTG TTATTATCAA TGTAGAAATT TGGAGATCAA AGTAGGGTTT ATAACTTCTC ATCACAATTG AGTTTGCATC ATTCATCGTC TTTACTGTAT  ACAATAATCA CTATGTTTTT ATATAAGTGA TGTTTAAGGA TTTTGCACTC CAATTAAAAA ATCATTGAGT TTTTCTTAAT TTTTGAAATA AGACATCAAT ATTTTATTTA TCCAAAACAT  CTAAACCAAT AAAACATAAT TTACATAATT TAAAATAGTC AAAAACAGTA TTAAACAAAT CAATTAATTT TACATTGGAA AGTGAAAACA TCACTTAATT TAAAACAAAC AAAAAATCTC  CTAAAACTTC ATTTAAGAAC AAACATAGAG AGTATTTGAA TGCAAAAAAT GATCTTATAT CATTGAAAAT GTATGACATA GTCGCTAAAT TCAAATATAT TTGAAAAATT ACCATAAAAT  TTAGCAACAA TAACAACCGC TAGAGATTAT GCATAACACA TTTGATTGTA CTAGTCTTGT ATTGTATACT TAGATATTAA TAAATCTAAT ATTCAAACCA GCACTCACAT TTAATGTATA  TATATCCGTC CAACTATATA TCTAAAAAGT TAATTATAAG TTTAGGTAAC AAATCATTCA AATCAAAATG GCATTATAAA TCATACAAAT CAAGTCTTCA TCTATAAAAT TAAATGAAAC 
GTACCATCAC TCGATTCACT CCCACAATAT ATAATCACGA GAGTTCCAAG AAAACTCCCA AGTGAATAAG AGATCATCAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGTCAATGGTGTTCATAGTTCTAGCTCAAATCTCTCTCGTTGCCTTGTTTCCTCTTTGTATGGGTAATCAAACGAATGAAAGCACGACCACTGCCTCTCTCTCCCCTCAGTTT
TACGACAACTCATGCCCGAAAGCACAAGCGATCGTTCAATCTATCGTCGTCAAAGCATACTCCGATGACCCTCGCATGGCTGCCTCATTGCTTAGGCTACATTTCCATGACTGTTTCGTC
AAT
GTTTGACCAAATCTAGTCTCTTCTCAAAAGTTTAATGTTTGATATGAAAATATAAATATGGACATTGCTTGCTGTTTGGGTGGTGCAGGGATGTGATGGTTCAGTATTATTGGACAA
CAGCGGAACCATGGAAAGCGAGAAACGATCAGAGCCAAACCAAAACTCTGCTCGAGGGTTCGAAGTCATTGACGATATTAAGTCCACCTTGGAAAATGAATGTCCTCAAACAGTTTCTTG
CGCTGATATTTTGGCTCTCGTCGCTAGAGACTCCACTGTTATT
GTAAGTCAATATACTCGTGCGTAACACAATCATTAGGATGAATAATTGTTGCAAATGCTCGTTTTTAAATTCAATTA
TATATATACAGACGGGTGGACCGAATTGGGAAGTATATCTAGGAAGAAGAGACGCAAGAGATGCAAACCTGAATGGTTCCAACAACAACATTCCTTCTCCCAACTCCACGATTCAGACCT
TGGTCACCAAGTTCTACCTTCACGGACTCGATCTCACCGATCTTGTTGCTCTCTTAG
GTATATACTAGTTAATATACCTAACCAAGTCGGATCTTAAATGATAAACTATTTTTTGAAAAT
TGATGAATTGCATAGAGTTGTTAAGTTTATGGCAAGAATAGAATTAAGAGAATGAATCATTTCTGAAATAATGTTTAAACAATGATATAATTGGATTAAATCTTTTAACATTCTCTCACG
TAACTTTAGCATGTTAAATATATATATATTTGCACGAGCCAACACATATTGATATATATCAGAATTTCTAAAATCAATAACCATGCTTCGAATGATAGGAAGCCACACGATAGGAAACTC
GAGGTGTACGAATTTCAGACAAAGATTGTACAACCATTCTGGAAACAGCGATATCGACCAAACTTTGAATCAAAACTACGCCTCTATGTTGCAGCAGGGATGTCCGATCTCCGGTGACGA
CCAGAACCTCTTTGCTCTGGACTACGCGACGCCGACTAAGTTTGACAACTACTACTTCAAGAACTTGGTGAGTTACAAAGGACTCTTGAGCTCTGATGAGATTTTGTACACGAAAAGCAA
AGACTCCATGGAGCTTGTCAAGCTTTACGCCGAGAATGAAGAAGCGTTCTTTGAGCAATTCGCTAAGTCGATGGTGAAGATGGGAAATATCTCGCCATTGACTGGAAATGATGGTGAAAT
CAGGAGGATATGCCGGAGAGTTAACCATGAAGACGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGTCAATGGTGTTCATAGTTCTAGCTCAAATCTCTCTCGTTGCCTTGTTTCCTCTTTGTATGGGTAATCAAACGAATGAAAGCACGACCACTGCCTCTCTCTCCCCTCAGTTT
TACGACAACTCATGCCCGAAAGCACAAGCGATCGTTCAATCTATCGTCGTCAAAGCATACTCCGATGACCCTCGCATGGCTGCCTCATTGCTTAGGCTACATTTCCATGACTGTTTCGTC
AAT
GGATGTGATGGTTCAGTATTATTGGACAACAGCGGAACCATGGAAAGCGAGAAACGATCAGAGCCAAACCAAAACTCTGCTCGAGGGTTCGAAGTCATTGACGATATTAAGTCCACC
TTGGAAAATGAATGTCCTCAAACAGTTTCTTGCGCTGATATTTTGGCTCTCGTCGCTAGAGACTCCACTGTTATT
ACGGGTGGACCGAATTGGGAAGTATATCTAGGAAGAAGAGACGCA
AGAGATGCAAACCTGAATGGTTCCAACAACAACATTCCTTCTCCCAACTCCACGATTCAGACCTTGGTCACCAAGTTCTACCTTCACGGACTCGATCTCACCGATCTTGTTGCTCTCTTA
G
GAAGCCACACGATAGGAAACTCGAGGTGTACGAATTTCAGACAAAGATTGTACAACCATTCTGGAAACAGCGATATCGACCAAACTTTGAATCAAAACTACGCCTCTATGTTGCAGCAG
GGATGTCCGATCTCCGGTGACGACCAGAACCTCTTTGCTCTGGACTACGCGACGCCGACTAAGTTTGACAACTACTACTTCAAGAACTTGGTGAGTTACAAAGGACTCTTGAGCTCTGAT
GAGATTTTGTACACGAAAAGCAAAGACTCCATGGAGCTTGTCAAGCTTTACGCCGAGAATGAAGAAGCGTTCTTTGAGCAATTCGCTAAGTCGATGGTGAAGATGGGAAATATCTCGCCA
TTGACTGGAAATGATGGTGAAATCAGGAGGATATGCCGGAGAGTTAACCATGAAGACGTCTAG

Retrieve as FASTA