Entry information : AtrPrx14 (AMTR_s00069p00173890)
Entry ID 13077
Creation 2015-02-10 (Christophe Dunand)
Last sequence changes 2015-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-04-06 (Marcel Zamocky)
Peroxidase information: AtrPrx14 (AMTR_s00069p00173890)
Name (synonym) AtrPrx14 (AMTR_s00069p00173890)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Amborellaceae Amborella
Organism Amborella trichopoda    [TaxId: 13333 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtrPrx14
start..stop
S start..stop
PpePrx62 445 6e-159 9..310 24..324
CsaPrx75 444 8e-159 10..310 17..316
LuPrx175 436 2e-155 10..310 22..321
GmPrx77 434 1e-154 10..310 23..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1532..1708 177 N° 2 1210..1398 189 N° 3 1..567 567  
complement(join(1..567,1210..1398,1532..1708))


exon

Literature and cross-references AtrPrx14 (AMTR_s00069p00173890)
DNA ref. GenBank:   NW_006500346.1 (2840017..2838310) [Incorrect prediction]
Cluster/Prediction ref. Genebank:   18447814 [Incorrect prediction]
Protein sequence: AtrPrx14 (AMTR_s00069p00173890)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310
PWM (Da):   %s   34127.2  
PI (pH):   %s   9.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMGSGTIRSEAKLSTSYYDRTCPQVERVVSETVWNASMHDSKVPPRILRMFFHDCFITGCDASVLLDSTPKNQAEKDAPPNVSLRSFYVIDQAKAKLETVCPRTVSCSDILTIAARDAVTLSGGPYWNMKKGRKDGKVSKASNTRGLPGPTFNVSQLLQSFSNRGLSKKDLVILSGGHTIGFSHCSSLKTRIRNFNSSHFSDPTMNPEFAVTLRTQCPPHNVNPNAGQLLDSTSRKFDNNYYKRLMGGKGVFGSDQDLFTDPRTRGLVELFAKDQGAFFREFAASMIKLGEVGVKDKDGEVRINCRIVN*

Retrieve as FASTA  
Remarks Complete sequence from DNA (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAATGGGCAGCGGAACAATTCGCTCAGAGGCAAAGCTGAGCACTTCTTACTACGACCGGACTTGCCCTCAAGTGGAGAGGGTGGTGTCTGAAACTGTATGGAACGCATCGATGCAC
GACTCCAAAGTCCCGCCCCGCATCCTCAGAATGTTCTTCCACGACTGCTTCATAACG
GTTAAACTCTCTCTCTTTCTAAAGCAAGCATGTTTAGCTAGGAGGACCCATGGATTCAGTGCA
ATAATGCTATGATCGAACCCCATGTATATCCAAGGTTTTAAATGTAATTTGGTCGTACTTTCTGTGGCAGGGATGCGACGCATCAGTGTTACTAGACTCGACTCCTAAAAACCAGGCAGA
GAAAGATGCACCACCCAATGTATCCTTGCGCTCTTTCTACGTGATAGACCAGGCCAAAGCTAAGCTCGAGACTGTTTGCCCGAGAACGGTCTCATGCTCTGACATCCTCACTATAGCAGC
AAGAGATGCAGTAACCCTG
GTACTTCCAATCCCTCACTCTACCACCACCCATATATATATATATATATATGGGTTTTCTACAATAAACTACTCAAATGGTGATTTCGGAAAATCGTACTT
CCAAACCTCTGAACATAAAATACCCTTCGGTCAGTCTAACTTTCAAGATGGGATATTTGAGGTAATTTTGAAACCCATTATAGATAGTAGGATGGAATAATGGGTGAGAGAGTCAGATTA
TAAAACTCACCTCCATTTCTCCTCCGAAATTCAGATTAATCTAAGTTATAAGGGCATTTATGATTTATGATAAAACTTCTGGATGCAAGGTTGTGTGCGTGTATTTATTTTCTATGCAAG
AGTGTATACATTGTCGATTTAACTGATGGATGGACGGTGATCGAGCATGAGTGGAACCAAGCCCTTGCATCATGTCATGTTCTCTCAAGATTTCAGCCTATTAATTGATTGGATGGTGAA
AGCATTTATGACCATTTCCATGAGCACGGCAATAGTTCCATTAAGGAATTATTGGACCTGCTCCTCCATCCTCCCTCAATTTCTCACCAACCCATCTGATAAAAATTCTATCACTTTCTT
CTCCACAAAATCCGACTGCATTTCCTTCCAAAATAATCAATGTTGCCTGTTGCCTCTACAGTCAGGAGGCCCATACTGGAACATGAAGAAGGGAAGGAAAGATGGTAAGGTTTCGAAGGC
CTCAAACACCAGAGGCCTACCAGGACCCACATTCAATGTCTCTCAGCTCCTCCAAAGCTTCTCAAACCGAGGCCTCTCTAAAAAAGACCTAGTGATCTTATCAGGAGGCCACACTATTGG
TTTCTCCCACTGCTCTTCCCTCAAAACACGGATTCGTAACTTCAATTCGAGCCATTTTTCTGACCCCACAATGAATCCTGAATTCGCTGTCACTCTTAGAACCCAATGCCCTCCCCACAA
TGTGAACCCTAATGCTGGCCAATTACTTGACTCCACTTCGAGAAAATTTGATAACAATTATTATAAAAGGTTGATGGGAGGTAAAGGAGTGTTTGGGTCTGACCAAGACTTGTTCACTGA
CCCTCGAACCAGAGGGCTTGTTGAACTGTTTGCAAAGGATCAAGGGGCATTCTTTAGAGAGTTTGCAGCTTCCATGATCAAGCTGGGGGAGGTAGGTGTGAAGGATAAGGATGGTGAAGT
CAGGATTAACTGCAGGATTGTTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAATGGGCAGCGGAACAATTCGCTCAGAGGCAAAGCTGAGCACTTCTTACTACGACCGGACTTGCCCTCAAGTGGAGAGGGTGGTGTCTGAAACTGTATGGAACGCATCGATGCAC
GACTCCAAAGTCCCGCCCCGCATCCTCAGAATGTTCTTCCACGACTGCTTCATAACG
GGATGCGACGCATCAGTGTTACTAGACTCGACTCCTAAAAACCAGGCAGAGAAAGATGCACCA
CCCAATGTATCCTTGCGCTCTTTCTACGTGATAGACCAGGCCAAAGCTAAGCTCGAGACTGTTTGCCCGAGAACGGTCTCATGCTCTGACATCCTCACTATAGCAGCAAGAGATGCAGTA
ACCCTG
TCAGGAGGCCCATACTGGAACATGAAGAAGGGAAGGAAAGATGGTAAGGTTTCGAAGGCCTCAAACACCAGAGGCCTACCAGGACCCACATTCAATGTCTCTCAGCTCCTCCAA
AGCTTCTCAAACCGAGGCCTCTCTAAAAAAGACCTAGTGATCTTATCAGGAGGCCACACTATTGGTTTCTCCCACTGCTCTTCCCTCAAAACACGGATTCGTAACTTCAATTCGAGCCAT
TTTTCTGACCCCACAATGAATCCTGAATTCGCTGTCACTCTTAGAACCCAATGCCCTCCCCACAATGTGAACCCTAATGCTGGCCAATTACTTGACTCCACTTCGAGAAAATTTGATAAC
AATTATTATAAAAGGTTGATGGGAGGTAAAGGAGTGTTTGGGTCTGACCAAGACTTGTTCACTGACCCTCGAACCAGAGGGCTTGTTGAACTGTTTGCAAAGGATCAAGGGGCATTCTTT
AGAGAGTTTGCAGCTTCCATGATCAAGCTGGGGGAGGTAGGTGTGAAGGATAAGGATGGTGAAGTCAGGATTAACTGCAGGATTGTTAACTGA

Retrieve as FASTA