Entry information : GbPrx51
Entry ID 13143
Creation 2015-04-14 (Christophe Dunand)
Last sequence changes 2015-04-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-12-01 (Christophe Dunand)
Peroxidase information: GbPrx51
Name GbPrx51
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Ginkgoopsida Ginkgoaceae Ginkgo
Organism Ginkgo biloba    [TaxId: 3311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GbPrx51
start..stop
S start..stop
PabPrx151 476 1e-170 8..337 14..342
MtPrx07 436 1e-154 36..337 26..327
StPrx23 432 3e-153 15..337 4..325
PtPrx89 429 3e-152 18..337 11..329
Literature and cross-references GbPrx51
Protein sequence: GbPrx51
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (304)
PWM (Da):   %s   36487.16 (32817.1)  
PI (pH):   %s   7.99 (6.50) Peptide Signal:   %s   cut: 34 range:34-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MPAKSASRIT SIVQKIFLAF TIWISHANYP VKADNLQVGF YNSRCNAAES IIQNAVSKAF MQNPGIAAGL IRMHFHDCFV NGCDGSVLID STSGNTAEKD SPANNPSLRG FEVIDEAKKN  LEVVCKGVVS CADIVAFAAR DSAKLAGEVS WDVPAGRRDG TVSKASDVQG NLPPSTFNVN QLTQRFAEKG LSQEEMVTLS GAHTIGRSHC ASFTNRLYNF NSTTGQDPSL DPTYANALKR 
QCPRKNPNGN TVVPMDTITP TVLDNVYYGD VLSNRGLFTS DQTLLTQPAT ASMVMQNWFD ILEWKNKFKA AMVRMGEVGV LTGSQGEIRL NCRVINS 

Retrieve as FASTA  
Remarks Complete sequence from genomic (no prediction from SymDB, scaffold10949) and RNA seq (gba_locus_61573_iso_1_len_1286_ver_2). No EST found.
scaffold10949 contains two fragments (pseudogenes) GAHTIGRSHCASFTNRLYNFNSTTGQDPSLDPTYANALKRQCPRRNPNGNTVVLMETITLTILDNVYYGEVLSNHFVYIHRLQYLQYP and GAHTIGCSHCDSFTNRIYNFNNTTGQDPSLDPMYVNALK*QCPRRNPNGNIVVPMETITLTILGNVYYREFLSNWGLFTS + LFTSD*TLLTQLATASMVMEN*FYMLEWKNKFKDSMVRMGEVGILTRS*GEIHLNCRIINS
DNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGCCTGCAA AATCAGCTAG CAGAATCACG AGTATAGTGC AAAAGATATT CTTAGCATTT ACTATATGGA TTTCTCATGC TAATTATCCT GTTAAAGCTG ACAATCTTCA AGTGGGTTTC  TATAATAGCC GCTGTAATGC AGCTGAAAGC ATAATCCAAA ATGCAGTTTC CAAGGCGTTT ATGCAAAATC CTGGAATAGC AGCTGGTCTT ATAAGGATGC ATTTCCACGA CTGCTTTGTC  AATGTAAGGG ACAATACATT GTGGTAATAT TGTATAATTA TTCACTGGCC TTCTCCATTT TTATAGCTAT TTACATATAT ATATATATAT ATATATATAA ATAATTTCAA TAATTATATT  AATAGTGTAT AGGTATTCAT TAATGAATGT TTTTCAGGGA TGCGATGGAT CAGTTCTGAT TGATTCGACT TCAGGGAATA CAGCAGAGAA GGACTCGCCT GCAAACAATC CCAGTCTTCG  AGGCTTCGAA GTAATTGATG AGGCAAAGAA GAATTTGGAA GCAGTTTGTA AGGGGGTGGT ATCATGTGCA GATATTGTAG CATTTGCAGC TCGTGATAGT GCAAAACTGG TAATGTTTTA  TGCTTATATA TTACTTCTAA TTTCAATGTC TATGCGATTC CATTATCAAT ATTGAGTTGA AAGATATATG CTAATAGTTT GTGTGTGTGT GTGTATTCAT TTGAAATATC GTAGGCGGGT  GAAGTGAGTT GGGATGTTCC AGCAGGCAGA AGAGATGGAA CGGTTTCAAA GGCTAGTGAC GTCCAAGGAA ATCTGCCTCC TTCCACATTT AATGTTAACC AACTGACACA AAGATTTGCA  GAAAAAGGTC TCTCGCAAGA AGAAATGGTC ACATTATCTG GTAAAATTTT CTTCTGGGTC GTTCGAAATA CTTATTTAAT CATGAAGTTG TAGTAGCCCA CAAAAGTCTC TGTTAAGGAA  ATCATTTGAA CCCATGTTTA CAATTTCTGT GACTATCCTA ACATTTTGAT CCAACATTTT GATATCATAA TAGTTACATA TTCATTACAG CACATATAGC TGCATATAGA TTGATTGATT  TCAATTGATA TTTTTATGTT TTATACACAA CTAGACATCT TGGACGACCA TATGCATTAA TCCTGCAACA GCGACAGAAT CTTCAAATTC ATCTGTAATA TTTTTTATCC CATATTAATG  GATAGATCAC TGATTTTAGT CAATAATTCA GGCTACGCTC CATAGACAAT TTTTTCTTAA AATAATTTTT TTAACGAGAG GACAGCAATG AAATCAAATA TAAACTAATC TTAGACTTTA  GAGAAACAGC TATTCTCATC ATCTGCATCA CAATATACAT GAATATTAAT TATCTCTTAG CATTTCTTTT ATTTAAAATT CAGATAATCG AAATTTTCAA TGCTGTGCGT TTTAGTAGCC  ATACAATAAC AATGCAACAC TAGCTACTAA CTCTGATATG TTAAATTATT ACAGGAGCTC ATACAATTGG TCGTTCGCAC TGCGCTTCAT TCACAAACAG GCTTTACAAC TTCAACAGCA  CAACGGGTCA AGACCCAAGT CTGGATCCAA CGTATGCGAA TGCACTCAAG CGACAATGTC CTCGAAAAAA CCCCAATGGA AATACTGTGG TGCCAATGGA CACCATCACA CCGACTGTTT  TGGATAATGT TTATTACGGA GACGTTCTTT CGAATCGGGG TTTGTTTACC TCTGATCAGA CACTGCTCAC ACAACCAGCG ACTGCAAGCA TGGTTATGCA GAACTGGTTT GACATTTTGG 
AGTGGAAGAA CAAGTTCAAA GCCGCCATGG TGAGGATGGG CGAGGTCGGT GTACTCACTG GAAGCCAGGG CGAGATTCGT TTGAATTGCC GAGTTATCAA CTCTTGA 

Retrieve as FASTA  
CDS
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGCCTGCAA AATCAGCTAG CAGAATCACG AGTATAGTGC AAAAGATATT CTTAGCATTT ACTATATGGA TTTCTCATGC TAATTATCCT GTTAAAGCTG ACAATCTTCA AGTGGGTTTC  TATAATAGCC GCTGTAATGC AGCTGAAAGC ATAATCCAAA ATGCAGTTTC CAAGGCGTTT ATGCAAAATC CTGGAATAGC AGCTGGTCTT ATAAGGATGC ATTTCCACGA CTGCTTTGTC  AATGGATGCG ATGGATCAGT TCTGATTGAT TCGACTTCAG GGAATACAGC AGAGAAGGAC TCGCCTGCAA ACAATCCCAG TCTTCGAGGC TTCGAAGTAA TTGATGAGGC AAAGAAGAAT  TTGGAAGTAG TTTGTAAGGG GGTGGTATCA TGTGCAGATA TTGTAGCATT TGCAGCTCGT GATAGTGCAA AACTGGCGGG TGAAGTGAGT TGGGATGTTC CAGCAGGCAG AAGAGATGGA  ACGGTTTCAA AGGCTAGTGA CGTCCAAGGA AATCTGCCTC CTTCCACATT TAATGTTAAC CAACTGACAC AAAGATTTGC AGAAAAAGGT CTCTCGCAAG AAGAAATGGT CACATTATCT  GGAGCTCATA CAATTGGTCG TTCGCACTGC GCTTCATTCA CAAACAGGCT TTACAACTTC AACAGCACAA CGGGTCAAGA CCCAAGTCTG GATCCAACGT ATGCGAATGC ACTCAAGCGA  CAATGTCCTC GAAAAAACCC CAATGGAAAT ACTGTGGTGC CAATGGACAC CATCACACCG ACTGTTTTGG ATAATGTTTA TTACGGAGAC GTTCTTTCGA ATCGGGGTTT GTTTACCTCT  GATCAGACAC TGCTCACACA ACCAGCGACT GCAAGCATGG TTATGCAGAA CTGGTTTGAC ATTTTGGAGT GGAAGAACAA GTTCAAAGCC GCCATGGTGA GGATGGGCGA GGTCGGTGTA 
CTCACTGGAA GCCAGGGCGA GATTCGTTTG AATTGCCGAG TTATCAACTC TTGA 

Retrieve as FASTA  
cDNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
CACTTGAGCT TAGTTTTTCT CAAACCAGTT ATATTTATAG AAGCATTTCT GATACAACAT GCCTGCAAAA TCAGCTAGCA GAATCACGAG TATAGTGCAA AAGATATTCT TAGCATTTAC  TATATGGATT TCTCATGCTA ATTATCCTGT TAAAGCTGAC AATCTTCAAG TGGGTTTCTA TAATAGCCGC TGTAATGCAG CTGAAAGCAT AATCCAAAAT GCAGTTTCCA AGGCGTTTAT  GCAAAATCCT GGAATAGCAG CTGGTCTTAT AAGGATGCAT TTCCACGACT GCTTTGTCAA TGGATGCGAT GGATCAGTTC TGATTGATTC GACTTCAGGG AATACAGCAG AGAAGGACTC  GCCTGCAAAC AATCCCAGTC TTCGAGGCTT CGAAGTAATT GATGAGGCAA AGAAGAATTT GGAAGTAGTT TGTAAGGGGG TGGTATCATG TGCAGATATT GTAGCATTTG CAGCTCGTGA  TAGTGCAAAA CTGGCGGGTG AAGTGAGTTG GGATGTTCCA GCAGGCAGAA GAGATGGAAC GGTTTCAAAG GCTAGTGACG TCCAAGGAAA TCTGCCTCCT TCCACATTTA ATGTTAACCA  ACTGACACAA AGATTTGCAG AAAAAGGTCT CTCGCAAGAA GAAATGGTCA CATTATCTGG AGCTCATACA ATTGGTCGTT CGCACTGCGC TTCATTCACA AACAGGCTTT ACAACTTCAA  CAGCACAACG GGTCAAGACC CAAGTCTGGA TCCAACGTAT GCGAATGCAC TCAAGCGACA ATGTCCTCGA AAAAACCCCA ATGGAAATAC TGTGGTGCCA ATGGACACCA TCACACCGAC  TGTTTTGGAT AATGTTTATT ACGGAGACGT TCTTTCGAAT CGGGGTTTGT TTACCTCTGA TCAGACACTG CTCACACAAC CAGCGACTGC AAGCATGGTT ATGCAGAACT GGTTTGACAT  TTTGGAGTGG AAGAACAAGT TCAAAGCCGC CATGGTGAGG ATGGGCGAGG TCGGTGTACT CACTGGAAGC CAGGGCGAGA TTCGTTTGAA TTGCCGAGTT ATCAACTCTT GAATGAAATT  GAACCCACAT CATTTATACC ACCATTGTAA TATCGTTTAG AGGACCGTTT GTAGGTTTGA TTTGCTATTT TGATCAGTCT CCAGACGTTT TATCCGTTGT AAATGTCAGn nnnnnnnnnG 
TTTTATCCGT TGTAAATGTC AGAAGGTGTC ATCCTAATTT CTGGATTTAA ATTCAGAGTC ATTCAATATG AGCGAAATAT GAGATA 

Retrieve as FASTA