Entry information : CfioCIIAA04_PJ7
Entry ID 13156
Creation 2015-04-20 (Christophe Dunand)
Last sequence changes 2015-04-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioCIIAA04_PJ7
Name CfioCIIAA04_PJ7
Class Asco Class II type A    [Orthogroup: CIIAA002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioCIIAA04_PJ7
start..stop
S start..stop
CfioCIIAA04_MH18 737 0 1..366 1..366
CgraCIIAA04 539 0 4..360 5..368
ChigCIIAA04 533 0 45..366 99..419
CgloCIIAA05_ST23 434 3e-153 16..359 14..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..993 993 N° 2 1052..1159 108  
join(1..993,1052..1159)


exon

Literature and cross-references CfioCIIAA04_PJ7
Literature Baroncelli,R., Sreenivasaprasad,S., Sukno,S.A., Thon,M.R. and Holub,E. Draft Genome Sequence of Colletotrichum acutatum Sensu Lato (Colletotrichum fioriniae). Genome Announc 2 (2) (2014)
DNA ref. GenBank:   NW_006889415.1 (74461..73303)
Cluster/Prediction ref. Genebank:   19033979
Protein sequence: CfioCIIAA04_PJ7
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (347)
PWM (Da):   %s   37691.77 (35938.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.88 (4.78) Peptide Signal:   %s   cut: 20 range:20-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGSKALIALTALVAVATAYPGMGRGGAGTSHGDMMAHLASREGAADNQNLGDLLKIPDGSLSDVGKDVKGILTGSGSPTTSDAASGNLPDLGSSDCNADKCCVWQHVAADLMPTFRDDNGCTDPARAAIRLGFHDAAGWSLNTGDLGGADGSIVLAPEEIGRPLNKGLEEIVSQMKTWFDKYKDHGAGMADLIQFAANTATVACPGGPRIKTFVGRKDSSVAAPDGLLPDPKDPADKLIELFGNKTISAPGLAALVGAHTASRQRFFDTSKVNAPQDTTPNVWDVDFYGQTLAGAPAEVVTFPSDTVLSKDPRSAPAFQAFANNAPLWGGAYAKQYLRLSLLGVFNINDLTDCSKALPAGTGVKR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGATCGAAAGCACTCATTGCTCTCACGGCACTCGTAGCCGTTGCCACTGCATACCCCGGCATGGGACGGGGCGGTGCCGGAACGAGCCACGGAGATATGATGGCGCATCTCGCT
AGCCGAGAGGGTGCCGCAGACAACCAAAATCTCGGCGATCTCCTCAAGATCCCCGACGGATCCTTGTCCGACGTCGGCAAGGATGTAAAGGGCATCCTTACGGGCTCCGGATCGCCAACC
ACGTCCGATGCCGCCAGCGGCAACCTCCCTGATCTCGGCAGCTCCGACTGCAACGCGGATAAGTGCTGTGTGTGGCAGCACGTCGCTGCCGACCTGATGCCCACGTTCCGTGACGACAAT
GGCTGCACCGACCCTGCCCGCGCCGCCATCCGCCTCGGATTCCATGACGCTGCTGGGTGGAGCTTGAACACCGGCGACCTCGGCGGTGCCGATGGCTCCATCGTTCTCGCTCCCGAGGAA
ATCGGGCGCCCTCTCAACAAGGGCTTGGAGGAGATTGTATCGCAGATGAAGACGTGGTTCGACAAGTACAAGGATCACGGTGCCGGTATGGCAGACTTGATCCAGTTTGCCGCCAACACC
GCGACGGTGGCATGCCCTGGGGGACCGAGAATCAAGACTTTCGTTGGCCGCAAGGATTCTTCCGTGGCTGCTCCCGATGGTTTGCTTCCGGACCCGAAGGACCCCGCCGACAAGCTGATC
GAGCTGTTTGGCAACAAGACTATCAGTGCCCCTGGTCTTGCCGCCCTTGTCGGTGCGCACACTGCCAGCCGTCAACGCTTCTTCGACACATCCAAGGTCAACGCCCCGCAGGATACCACG
CCCAATGTCTGGGATGTTGACTTTTACGGACAAACTTTGGCTGGAGCTCCTGCCGAGGTTGTTACCTTCCCCAGTGACACCGTTCTGTCCAAGGATCCCCGTTCGGCTCCGGCATTCCAG
GCCTTCGCTAATAACGCACCGCTTTGGGGCGGA
GTAAGTTTACACTTAATCCCATCTTAGTACTTCAGGAGTATAGCTAACCAAATTACAGGCATATGCCAAGCAGTACCTCCGTTTGAG
TCTCCTTGGTGTCTTCAACATCAATGACTTGACTGATTGCAGCAAGGCGCTCCCCGCCGGTACCGGTGTCAAGAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGATCGAAAGCACTCATTGCTCTCACGGCACTCGTAGCCGTTGCCACTGCATACCCCGGCATGGGACGGGGCGGTGCCGGAACGAGCCACGGAGATATGATGGCGCATCTCGCT
AGCCGAGAGGGTGCCGCAGACAACCAAAATCTCGGCGATCTCCTCAAGATCCCCGACGGATCCTTGTCCGACGTCGGCAAGGATGTAAAGGGCATCCTTACGGGCTCCGGATCGCCAACC
ACGTCCGATGCCGCCAGCGGCAACCTCCCTGATCTCGGCAGCTCCGACTGCAACGCGGATAAGTGCTGTGTGTGGCAGCACGTCGCTGCCGACCTGATGCCCACGTTCCGTGACGACAAT
GGCTGCACCGACCCTGCCCGCGCCGCCATCCGCCTCGGATTCCATGACGCTGCTGGGTGGAGCTTGAACACCGGCGACCTCGGCGGTGCCGATGGCTCCATCGTTCTCGCTCCCGAGGAA
ATCGGGCGCCCTCTCAACAAGGGCTTGGAGGAGATTGTATCGCAGATGAAGACGTGGTTCGACAAGTACAAGGATCACGGTGCCGGTATGGCAGACTTGATCCAGTTTGCCGCCAACACC
GCGACGGTGGCATGCCCTGGGGGACCGAGAATCAAGACTTTCGTTGGCCGCAAGGATTCTTCCGTGGCTGCTCCCGATGGTTTGCTTCCGGACCCGAAGGACCCCGCCGACAAGCTGATC
GAGCTGTTTGGCAACAAGACTATCAGTGCCCCTGGTCTTGCCGCCCTTGTCGGTGCGCACACTGCCAGCCGTCAACGCTTCTTCGACACATCCAAGGTCAACGCCCCGCAGGATACCACG
CCCAATGTCTGGGATGTTGACTTTTACGGACAAACTTTGGCTGGAGCTCCTGCCGAGGTTGTTACCTTCCCCAGTGACACCGTTCTGTCCAAGGATCCCCGTTCGGCTCCGGCATTCCAG
GCCTTCGCTAATAACGCACCGCTTTGGGGCGGA
GCATATGCCAAGCAGTACCTCCGTTTGAGTCTCCTTGGTGTCTTCAACATCAATGACTTGACTGATTGCAGCAAGGCGCTCCCCGCC
GGTACCGGTGTCAAGAGATAG

Retrieve as FASTA