Entry information : CgloCIIAA01_Naragc5 (ligninaseh2)
Entry ID 13168
Creation 2015-04-21 (Christophe Dunand)
Last sequence changes 2015-04-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-22 (Christophe Dunand)
Peroxidase information: CgloCIIAA01_Naragc5 (ligninaseh2)
Name (synonym) CgloCIIAA01_Naragc5 (ligninaseh2)
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCIIAA01_Naragc5
start..stop
S start..stop
CgloCIIAA01_ST23 830 0 1..402 1..402
CgraCIIAA03 561 0 1..401 1..402
CfioCIIAA03_MH18 553 0 1..401 1..402
CfioCIIAA03_PJ7 551 0 1..401 1..402
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8..1000 993 N° 2 1054..1269 216  
join(8..1000,1054..1269)


exon

Literature and cross-references CgloCIIAA01_Naragc5 (ligninaseh2)
Literature Gan,P.H.P., Ikeda,K., Irieda,H., Narusaka,M., O'Connell,R.J., Narusaka,Y., Takano,Y., Kubo,Y. and Shirasu,K. Genome analysis of Colletotrichum orbiculare and Colletotrichum gloeosporioides
DNA ref. GenBank:   NW_006762473.1 (94398..95666)
Cluster/Prediction ref. Genebank:   18735837
Protein sequence: CgloCIIAA01_Naragc5 (ligninaseh2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   402 (385)
PWM (Da):   %s   43127.5 (41482.6)  
PI (pH):   %s   8.38 (8.20) Peptide Signal:   %s   cut: 18 range:18-402
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTASFITALLAGVAVAHPGMNMEQIREEARLQNRQSGGGGGSTELIGDLATLPDAKLTKTGREIKAILTLQSSGQDQASTYEAPGKKNSAECKADKCCIWKFIADDMVKQMVGNAGRCNSVARASVRLGFHDASSWSKTSGGTGADGSIILANECHTRDDNKGLEEICDTMQGWFDKYKKYGVSMADMIQFAANVATVACPLGPRVRTFVGRKDTTKASPPNLLPSPFQKSDALFKMFAQKSFTPDGLVALLGAHTTSQQRFVDPSRAGAPQDTTPGVWDVAFYGQTLNPRTPPAVFKIPSDVSISQDPKVIDTWKAFGAGRRGQMAWNQAYSSEYVRMSLLGVPNMNDLTECTKVLPPFKGADFQMPDQSELDKFMNGILKSPQAVQALDAGNIIPPTAQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Incorrect prediction from NCBI (extra intron due to frame shift and extra repeated seq: GTCTCGG).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCGCGTCTTTCATCACCGCCCTCCTGGCCGGCGTCGCCGTTGCCCACCCCGGCATGAACATGGAGCAGATCAGGGAGGAGGCCCGCCTCCAGAACCGCCAGTCCGGCGGCGGC
GGCGGTTCCACCGAACTGATTGGAGACCTCGCTACTCTTCCCGATGCTAAGCTCACCAAGACGGGCCGCGAGATCAAGGCCATCTTGACCCTCCAGTCCAGCGGCCAGGACCAGGCTTCC
ACCTACGAGGCCCCCGGCAAGAAGAACTCGGCCGAGTGCAAGGCAGACAAGTGCTGCATCTGGAAGTTCATCGCAGACGACATGGTCAAGCAGATGGTCGGCAACGCAGGCCGCTGCAAC
AGCGTCGCCCGCGCCTCCGTCCGTCTCGGCTTCCACGACGCCTCCTCCTGGTCCAAGACCTCGGGTGGTACCGGCGCCGACGGCTCCATCATTCTCGCCAACGAGTGCCACACTCGCGAC
GACAACAAGGGCCTCGAGGAGATCTGCGACACCATGCAGGGCTGGTTCGACAAGTACAAGAAGTACGGCGTCTCCATGGCCGACATGATCCAGTTCGCCGCCAACGTCGCCACTGTCGCC
TGCCCCCTCGGCCCTCGCGTCCGCACCTTCGTCGGCCGCAAGGACACCACCAAGGCCTCCCCGCCGAACCTGCTGCCTTCCCCCTTCCAGAAGTCCGACGCTCTGTTCAAGATGTTCGCC
CAGAAGTCCTTCACCCCCGACGGCCTCGTCGCCCTGCTCGGCGCGCACACCACCTCCCAGCAGCGCTTCGTCGATCCCAGCAGAGCCGGCGCCCCGCAGGACACCACCCCCGGCGTCTGG
GACGTCGCCTTCTACGGCCAGACCCTGAACCCCAGGACCCCGCCCGCCGTCTTCAAGATTCCCTCCGACGTCAGCATCTCCCAGGACCCCAAGGTCATCGACACCTGGAAGGCGTTTGGC
GCCGGCCGTCGTGGTCAAATGGCATGGAACCAG
GTACGCATCTCCCCCCTCATCCCTCTTGTATCCCCATCTCTAACACCTCCCAGGCCTACTCCTCCGAATACGTCCGCATGTCCCTCC
TCGGCGTTCCCAACATGAACGATCTCACCGAGTGCACCAAGGTCCTGCCCCCCTTCAAGGGCGCCGACTTCCAGATGCCCGACCAGTCCGAGCTTGACAAGTTCATGAACGGCATCCTCA
AGTCGCCCCAGGCCGTCCAGGCGCTCGACGCCGGCAACATCATCCCTCCCACCGCCCAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCGCGTCTTTCATCACCGCCCTCCTGGCCGGCGTCGCCGTTGCCCACCCCGGCATGAACATGGAGCAGATCAGGGAGGAGGCCCGCCTCCAGAACCGCCAGTCCGGCGGCGGC
GGCGGTTCCACCGAACTGATTGGAGACCTCGCTACTCTTCCCGATGCTAAGCTCACCAAGACGGGCCGCGAGATCAAGGCCATCTTGACCCTCCAGTCCAGCGGCCAGGACCAGGCTTCC
ACCTACGAGGCCCCCGGCAAGAAGAACTCGGCCGAGTGCAAGGCAGACAAGTGCTGCATCTGGAAGTTCATCGCAGACGACATGGTCAAGCAGATGGTCGGCAACGCAGGCCGCTGCAAC
AGCGTCGCCCGCGCCTCCGTCCGTCTCGGCTTCCACGACGCCTCCTCCTGGTCCAAGACCTCGGGTGGTACCGGCGCCGACGGCTCCATCATTCTCGCCAACGAGTGCCACACTCGCGAC
GACAACAAGGGCCTCGAGGAGATCTGCGACACCATGCAGGGCTGGTTCGACAAGTACAAGAAGTACGGCGTCTCCATGGCCGACATGATCCAGTTCGCCGCCAACGTCGCCACTGTCGCC
TGCCCCCTCGGCCCTCGCGTCCGCACCTTCGTCGGCCGCAAGGACACCACCAAGGCCTCCCCGCCGAACCTGCTGCCTTCCCCCTTCCAGAAGTCCGACGCTCTGTTCAAGATGTTCGCC
CAGAAGTCCTTCACCCCCGACGGCCTCGTCGCCCTGCTCGGCGCGCACACCACCTCCCAGCAGCGCTTCGTCGATCCCAGCAGAGCCGGCGCCCCGCAGGACACCACCCCCGGCGTCTGG
GACGTCGCCTTCTACGGCCAGACCCTGAACCCCAGGACCCCGCCCGCCGTCTTCAAGATTCCCTCCGACGTCAGCATCTCCCAGGACCCCAAGGTCATCGACACCTGGAAGGCGTTTGGC
GCCGGCCGTCGTGGTCAAATGGCATGGAACCAG
GCCTACTCCTCCGAATACGTCCGCATGTCCCTCCTCGGCGTTCCCAACATGAACGATCTCACCGAGTGCACCAAGGTCCTGCCCCCC
TTCAAGGGCGCCGACTTCCAGATGCCCGACCAGTCCGAGCTTGACAAGTTCATGAACGGCATCCTCAAGTCGCCCCAGGCCGTCCAGGCGCTCGACGCCGGCAACATCATCCCTCCCACC
GCCCAATAG

Retrieve as FASTA