Entry information : CgloCIIAA03_Naragc5
Entry ID 13170
Creation 2015-04-21 (Christophe Dunand)
Last sequence changes 2015-04-21 (Christophe Dunand)
Sequence status partial
Reviewer Catherine Mathe
Last annotation changes 2017-05-02 (Catherine Mathe)
Peroxidase information: CgloCIIAA03_Naragc5
Name CgloCIIAA03_Naragc5
Class Asco Class II type A     [Orthogroup: CIIAA001]*
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCIIAA03_Naragc5
start..stop
S start..stop
CgloCIIAA03_ST23 793 0 1..406 1..409
CfioCIIAA01_PJ7 681 0 1..406 1..411
ChigCIIAA01 678 0 1..404 1..410
CfioCIIAA01_MH18 676 0 1..404 1..409
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..981 981 N° 2 1036..1275 240  
join(1..981,1036..1275)


exon

Literature and cross-references CgloCIIAA03_Naragc5
Literature Gan,P.H.P., Ikeda,K., Irieda,H., Narusaka,M., O'Connell,R.J., Narusaka,Y., Takano,Y., Kubo,Y. and Shirasu,K. Genome analysis of Colletotrichum orbiculare and Colletotrichum gloeosporioides
DNA ref. GenBank:   NW_006762182.1 (21463..22737)
Cluster/Prediction ref. Genebank:   18743418
Protein sequence: CgloCIIAA03_Naragc5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   406 (388)
PWM (Da):   %s   43229.94 (41385.0)  
PI (pH):   %s   7.5 (7.46) Peptide Signal:   %s   cut: 19 range:19-406
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLTSFLTTSLAISGTLAYPSMGNQISEIMSRASDKGDSTELLGDLITLKDRDLTPVGKDVKKLLQGKGTPESNDRYILPVPALNSDKCKKDTCCVWRYVADDMYQFMAGSSGRCTKWARAAVRLGFHDAxxxxxxxxxxxYGIIILSGEEIGRFENRGLQEVAARFAELHGKYKAMGWNIGMGDFIQMGANVATVVCPLGPRIKTYVGRKDSANPAPAGLLPSPFAPADQLIQLFKDKTIGPHGLVALLGAHTTSQQNFVNESRAGDPQDSTPGVWDVLYYKETLSDRSPPRVFKFPSDISISQHPETSKEFREFAGPGGQNHWNEDYAREYIRLSLLGVDNINQLTECTKVLPPATKGFRILDQFKLDKWLNSVGSKGAAKKVSQDIENGDTVTVDVPPVNNRN

Retrieve as FASTA  
Remarks Partial sequence from genomic (1 intron). N in the sequence
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTCACATCCTTCCTCACAACCTCCCTCGCCATCTCCGGCACCCTCGCCTACCCGAGCATGGGCAACCAAATTTCCGAAATCATGTCCCGCGCCTCCGACAAAGGCGACTCAACC
GAGCTCCTCGGCGACCTAATCACTCTCAAAGACCGCGACCTCACCCCCGTCGGCAAGGACGTCAAGAAGCTCCTCCAGGGCAAGGGCACCCCCGAGTCCAACGACCGCTACATCCTCCCC
GTGCCCGCGCTTAACTCGGACAAGTGCAAGAAGGACACGTGCTGCGTCTGGCGCTACGTCGCCGACGACATGTATCAGTTCATGGCCGGCTCCTCGGGACGCTGCACAAAGTGGGCGCGC
GCCGCCGTCCGCCTCGGCTTCCACGACGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTACGGCATCATCATCCTGTCCGGGGAGGAGATCGGCCGCTTCGAGAACCGCGGGCTG
CAGGAGGTCGCCGCGCGCTTCGCGGAGCTGCACGGCAAGTACAAGGCCATGGGCTGGAACATCGGCATGGGCGACTTCATCCAGATGGGCGCCAACGTCGCGACGGTGGTGTGCCCGCTC
GGCCCGCGCATCAAGACGTACGTCGGCCGCAAGGACAGCGCGAACCCCGCGCCGGCGGGCCTGCTGCCGAGCCCGTTTGCGCCCGCGGACCAGCTGATCCAGCTGTTCAAGGACAAGACA
ATCGGGCCTCATGGGCTGGTTGCGCTGCTTGGCGCGCATACGACGAGCCAGCAGAACTTTGTCAATGAGTCGAGGGCCGGCGATCCGCAGGACAGCACCCCCGGTGTGTGGGATGTGTTG
TACTACAAGGAGACGCTGAGCGACCGCTCGCCTCCCCGTGTGTTCAAGTTCCCCTCGGATATCTCCATCTCGCAGCACCCTGAGACCAGCAAAGAGTTCAGGGAGTTCGCTGGACCTGGT
GGACAGAACCACTGGAACGAG
GTATGTTTCCTTCAGAGTTGAGATTTGGGGTGTTATGACTGACAGTGGTGACAGGACTACGCCAGAGAGTACATCCGTCTGTCGCTGCTTGGTGTGGAT
AACATCAACCAGCTTACCGAGTGCACCAAGGTTCTCCCTCCTGCGACTAAGGGCTTCCGCATCCTCGACCAGTTCAAGCTCGACAAGTGGCTGAACAGCGTCGGCAGCAAGGGCGCCGCC
AAGAAGGTGTCTCAGGACATTGAAAACGGTGACACTGTCACTGTTGATGTTCCTCCCGTCAACAACCGCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTCACATCCTTCCTCACAACCTCCCTCGCCATCTCCGGCACCCTCGCCTACCCGAGCATGGGCAACCAAATTTCCGAAATCATGTCCCGCGCCTCCGACAAAGGCGACTCAACC
GAGCTCCTCGGCGACCTAATCACTCTCAAAGACCGCGACCTCACCCCCGTCGGCAAGGACGTCAAGAAGCTCCTCCAGGGCAAGGGCACCCCCGAGTCCAACGACCGCTACATCCTCCCC
GTGCCCGCGCTTAACTCGGACAAGTGCAAGAAGGACACGTGCTGCGTCTGGCGCTACGTCGCCGACGACATGTATCAGTTCATGGCCGGCTCCTCGGGACGCTGCACAAAGTGGGCGCGC
GCCGCCGTCCGCCTCGGCTTCCACGACGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTACGGCATCATCATCCTGTCCGGGGAGGAGATCGGCCGCTTCGAGAACCGCGGGCTG
CAGGAGGTCGCCGCGCGCTTCGCGGAGCTGCACGGCAAGTACAAGGCCATGGGCTGGAACATCGGCATGGGCGACTTCATCCAGATGGGCGCCAACGTCGCGACGGTGGTGTGCCCGCTC
GGCCCGCGCATCAAGACGTACGTCGGCCGCAAGGACAGCGCGAACCCCGCGCCGGCGGGCCTGCTGCCGAGCCCGTTTGCGCCCGCGGACCAGCTGATCCAGCTGTTCAAGGACAAGACA
ATCGGGCCTCATGGGCTGGTTGCGCTGCTTGGCGCGCATACGACGAGCCAGCAGAACTTTGTCAATGAGTCGAGGGCCGGCGATCCGCAGGACAGCACCCCCGGTGTGTGGGATGTGTTG
TACTACAAGGAGACGCTGAGCGACCGCTCGCCTCCCCGTGTGTTCAAGTTCCCCTCGGATATCTCCATCTCGCAGCACCCTGAGACCAGCAAAGAGTTCAGGGAGTTCGCTGGACCTGGT
GGACAGAACCACTGGAACGAG
GACTACGCCAGAGAGTACATCCGTCTGTCGCTGCTTGGTGTGGATAACATCAACCAGCTTACCGAGTGCACCAAGGTTCTCCCTCCTGCGACTAAGGGC
TTCCGCATCCTCGACCAGTTCAAGCTCGACAAGTGGCTGAACAGCGTCGGCAGCAAGGGCGCCGCCAAGAAGGTGTCTCAGGACATTGAAAACGGTGACACTGTCACTGTTGATGTTCCT
CCCGTCAACAACCGCAACTAG

Retrieve as FASTA