Entry information : CgloCIIAA05_Naragc5
Entry ID 13173
Creation 2015-04-22 (Christophe Dunand)
Last sequence changes 2015-04-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-22 (Christophe Dunand)
Peroxidase information: CgloCIIAA05_Naragc5
Name CgloCIIAA05_Naragc5
Class Asco Class II type A    [Orthogroup: CIIAA002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCIIAA05_Naragc5
start..stop
S start..stop
CgloCIIAA05_ST23 706 0 1..353 1..353
CfioCIIAA04_MH18 439 3e-155 4..350 6..359
CfioCIIAA04_PJ7 439 3e-155 4..350 6..359
CgraCIIAA04 432 2e-152 2..350 5..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..966 966 N° 2 1027..1122 96  
join(1..966,1027..1122)


exon

Literature and cross-references CgloCIIAA05_Naragc5
DNA ref. GenBank:   NW_006762277.1 (72459..71338.)
Cluster/Prediction ref. Genebank:   18745594
Protein sequence: CgloCIIAA05_Naragc5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (336)
PWM (Da):   %s   36779.31 (35097.5)  
PI (pH):   %s   5.66 (5.12) Peptide Signal:   %s   cut: 18 range:18-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHHAAMLLAAFAATSSAYPGWSAPGFMDELYARAGSISDQPLGDLATLPDSSLSQTGKDIKNILTTSASGQSTDQYQGAVPALGSKECAADKCCVWKHIGDELATKFADGSGCTQPARAAVRLGFHDASGWSIATGPGGGADGSIVLAPAEIKRALNEGLQDAVTQTQTWFNKYKQYGIGMADLIQFAANSGTVMCPKGPRVKTLIGRKDSSTACPDGLLPDVNDPVDKLIAIFANKTISPPGLAALVGAHTASTQKTVDPARAGAPQDTTPAVWDTLFYSQTLAGAPSNVFTFNSDKVLSQDSRSGPAFKAFADSQPAWNVAFSREYLRLSLLGVDNINELTDCTKSLPVPK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCACGCAGCTATGCTCCTGGCCGCCTTTGCGGCCACCTCTTCCGCTTACCCCGGCTGGTCTGCCCCGGGCTTCATGGATGAGCTCTATGCTAGAGCTGGTTCCATCAGCGACCAA
CCCTTGGGCGATCTTGCGACCCTCCCCGACTCATCTCTTAGCCAGACGGGCAAGGATATCAAGAATATCCTCACTACCTCCGCCTCTGGACAGTCGACCGATCAGTACCAGGGCGCCGTT
CCTGCGCTCGGCAGCAAGGAATGTGCCGCCGACAAGTGCTGCGTCTGGAAGCACATTGGAGACGAGCTCGCCACCAAGTTCGCAGACGGAAGTGGATGTACCCAACCCGCCCGCGCCGCC
GTTCGCCTCGGCTTCCACGATGCCTCCGGCTGGAGTATTGCCACCGGTCCTGGCGGTGGTGCTGACGGCTCCATTGTTCTCGCCCCTGCTGAGATCAAGCGCGCCCTCAACGAAGGTCTC
CAGGATGCGGTCACCCAGACCCAGACTTGGTTCAACAAGTACAAGCAGTACGGTATTGGCATGGCGGACCTGATCCAGTTCGCCGCCAACAGCGGCACCGTCATGTGCCCCAAGGGGCCC
AGGGTCAAGACCCTGATCGGCCGCAAGGATTCTTCCACGGCTTGCCCCGACGGTCTGCTGCCGGACGTCAACGACCCGGTCGACAAGCTCATTGCAATCTTCGCAAACAAGACCATCTCT
CCGCCTGGTCTTGCAGCCCTCGTCGGCGCCCACACCGCTTCCACCCAGAAGACCGTTGACCCGGCCCGCGCGGGTGCTCCTCAGGATACCACCCCTGCCGTCTGGGATACCCTCTTCTAC
TCGCAGACTTTGGCCGGTGCCCCCTCCAACGTCTTCACCTTCAACAGCGACAAGGTCCTCTCCCAGGACTCTCGCAGTGGACCGGCTTTCAAGGCTTTCGCTGACAGCCAGCCTGCCTGG
AACGTG
GTATGTTCTCATCTTCAGACATCATCTCAATAATGTGACATGAGTTCTAACATTTGGTAGGCGTTTTCAAGAGAGTACTTGCGTCTTAGTCTCCTCGGTGTTGACAACATCAAC
GAACTCACCGACTGCACCAAGTCTCTTCCTGTCCCCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCACGCAGCTATGCTCCTGGCCGCCTTTGCGGCCACCTCTTCCGCTTACCCCGGCTGGTCTGCCCCGGGCTTCATGGATGAGCTCTATGCTAGAGCTGGTTCCATCAGCGACCAA
CCCTTGGGCGATCTTGCGACCCTCCCCGACTCATCTCTTAGCCAGACGGGCAAGGATATCAAGAATATCCTCACTACCTCCGCCTCTGGACAGTCGACCGATCAGTACCAGGGCGCCGTT
CCTGCGCTCGGCAGCAAGGAATGTGCCGCCGACAAGTGCTGCGTCTGGAAGCACATTGGAGACGAGCTCGCCACCAAGTTCGCAGACGGAAGTGGATGTACCCAACCCGCCCGCGCCGCC
GTTCGCCTCGGCTTCCACGATGCCTCCGGCTGGAGTATTGCCACCGGTCCTGGCGGTGGTGCTGACGGCTCCATTGTTCTCGCCCCTGCTGAGATCAAGCGCGCCCTCAACGAAGGTCTC
CAGGATGCGGTCACCCAGACCCAGACTTGGTTCAACAAGTACAAGCAGTACGGTATTGGCATGGCGGACCTGATCCAGTTCGCCGCCAACAGCGGCACCGTCATGTGCCCCAAGGGGCCC
AGGGTCAAGACCCTGATCGGCCGCAAGGATTCTTCCACGGCTTGCCCCGACGGTCTGCTGCCGGACGTCAACGACCCGGTCGACAAGCTCATTGCAATCTTCGCAAACAAGACCATCTCT
CCGCCTGGTCTTGCAGCCCTCGTCGGCGCCCACACCGCTTCCACCCAGAAGACCGTTGACCCGGCCCGCGCGGGTGCTCCTCAGGATACCACCCCTGCCGTCTGGGATACCCTCTTCTAC
TCGCAGACTTTGGCCGGTGCCCCCTCCAACGTCTTCACCTTCAACAGCGACAAGGTCCTCTCCCAGGACTCTCGCAGTGGACCGGCTTTCAAGGCTTTCGCTGACAGCCAGCCTGCCTGG
AACGTG
GCGTTTTCAAGAGAGTACTTGCGTCTTAGTCTCCTCGGTGTTGACAACATCAACGAACTCACCGACTGCACCAAGTCTCTTCCTGTCCCCAAGTAA

Retrieve as FASTA