Entry information : CgloCcP01_Naragc5
Entry ID 13174
Creation 2015-04-23 (Christophe Dunand)
Last sequence changes 2015-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-23 (Christophe Dunand)
Peroxidase information: CgloCcP01_Naragc5
Name CgloCcP01_Naragc5
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCcP01_Naragc5
start..stop
S start..stop
CgloCcP01_ST23 737 0 1..361 1..361
CgraCcP01 680 0 1..359 1..359
ChigCcP 665 0 1..361 1..361
CfioCcP01_MH18 652 0 1..361 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..493 493 N° 2 553..1145 593  
join(1..493,553..1145)


exon

Literature and cross-references CgloCcP01_Naragc5
DNA ref. GenBank:   NW_006762271.1 (67511..66380)
Protein sequence: CgloCcP01_Naragc5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361
PWM (Da):   %s   39692.78  
PI (pH):   %s   9.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASTRQFARAAMRTTARNTFAVAPRQAFRQQGRRFYSSEPASKSGSSTWIWLTGAAVVGAGGYFYTREGGVSAGSTPKIVNPTKADYEKVYKAIADRLEENDEYXXXXXGPVLVRLAWHASGTFDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKKQFPWISYSDLWILGGVCAIQEMQGPVIPYRPGRKDGEAAACTPDGRLPDASKREKHLRDIFYRMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVLTNDYYKLLLNEKWQWKKWDGPAQYEDKGTKTLMMLPADYALIQDKTFKKYVEQYAKDNDSFFKDFSNVIVKLFELGVPFAQGEDQRWTFKPTWAE

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Incorect prediction from NCBI (extra intron predicted due to missing nucleotides (14 nt)). Sequence also found for Cg-14.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTACCAGACAATTTGCCCGCGCGGCGATGCGCACCACCGCTAGAAACACTTTCGCCGTCGCTCCTCGCCAGGCTTTCCGCCAGCAGGGCCGCCGCTTCTACTCTTCCGAG
CCAGCCTCCAAGTCCGGCAGCTCCACCTGGATCTGGCTCACCGGTGCCGCAGTCGTTGGAGCTGGCGGCTACTTCTACACCCGCGAGGGCGGCGTCTCTGCCGGCTCGACCCCCAAGATC
GTCAACCCCACCAAGGCCGACTACGAGAAGGTGTACAAGGCCATTGCCGACCGCCTCGAGGAGAACGACGAGTACGANNNNNNNNNNNNNGGCCCCGTCCTCGTCCGTCTGGCCTGGCAC
GCCAGCGGCACCTTCGACAAGGAGACCGGCACCGGTGGCAGCAACGGCGCCACCATGCGCTTCGCCCCTGAGTCCGACCACGGCGCCAACGCCGGTCTGAAGGCTGCCCGTGACTTCCTC
GAGCCCGTCAAGA
GTAGGTTGCTTCCGATTTGAAGTCGATTGCCCCAGCCAGAAATACTAACCTTCTTGCAGAGCAATTCCCCTGGATCTCCTACTCCGACCTCTGGATCCTCGGTGGCG
TCTGCGCCATCCAGGAGATGCAGGGCCCCGTCATCCCCTACCGCCCTGGCCGCAAGGACGGTGAGGCTGCTGCTTGCACTCCCGACGGTCGTCTCCCCGACGCCTCCAAGCGCGAGAAGC
ACCTTCGCGATATCTTTTACCGCATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCCGGCGCCCACGCCCTTGGCCGCTGCCACACCGACCGCTCTGGCTTCGACGGCCCCTGGACCT
TCTCCCCCACCGTTCTCACCAACGACTACTACAAGCTGCTCCTGAACGAGAAGTGGCAGTGGAAGAAGTGGGACGGCCCTGCCCAGTACGAGGACAAGGGCACCAAGACCTTAATGATGC
TTCCCGCCGACTACGCTCTGATCCAGGACAAGACCTTCAAGAAGTACGTTGAGCAGTACGCCAAGGACAACGACTCCTTCTTCAAGGACTTCTCCAACGTGATTGTCAAGCTGTTCGAGC
TCGGTGTCCCCTTTGCCCAGGGCGAGGACCAGCGTTGGACTTTCAAGCCCACTTGGGCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCTACCAGACAATTTGCCCGCGCGGCGATGCGCACCACCGCTAGAAACACTTTCGCCGTCGCTCCTCGCCAGGCTTTCCGCCAGCAGGGCCGCCGCTTCTACTCTTCCGAG
CCAGCCTCCAAGTCCGGCAGCTCCACCTGGATCTGGCTCACCGGTGCCGCAGTCGTTGGAGCTGGCGGCTACTTCTACACCCGCGAGGGCGGCGTCTCTGCCGGCTCGACCCCCAAGATC
GTCAACCCCACCAAGGCCGACTACGAGAAGGTGTACAAGGCCATTGCCGACCGCCTCGAGGAGAACGACGAGTACGANNNNNNNNNNNNNGGCCCCGTCCTCGTCCGTCTGGCCTGGCAC
GCCAGCGGCACCTTCGACAAGGAGACCGGCACCGGTGGCAGCAACGGCGCCACCATGCGCTTCGCCCCTGAGTCCGACCACGGCGCCAACGCCGGTCTGAAGGCTGCCCGTGACTTCCTC
GAGCCCGTCAAGA
AGCAATTCCCCTGGATCTCCTACTCCGACCTCTGGATCCTCGGTGGCGTCTGCGCCATCCAGGAGATGCAGGGCCCCGTCATCCCCTACCGCCCTGGCCGCAAGGAC
GGTGAGGCTGCTGCTTGCACTCCCGACGGTCGTCTCCCCGACGCCTCCAAGCGCGAGAAGCACCTTCGCGATATCTTTTACCGCATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCC
GGCGCCCACGCCCTTGGCCGCTGCCACACCGACCGCTCTGGCTTCGACGGCCCCTGGACCTTCTCCCCCACCGTTCTCACCAACGACTACTACAAGCTGCTCCTGAACGAGAAGTGGCAG
TGGAAGAAGTGGGACGGCCCTGCCCAGTACGAGGACAAGGGCACCAAGACCTTAATGATGCTTCCCGCCGACTACGCTCTGATCCAGGACAAGACCTTCAAGAAGTACGTTGAGCAGTAC
GCCAAGGACAACGACTCCTTCTTCAAGGACTTCTCCAACGTGATTGTCAAGCTGTTCGAGCTCGGTGTCCCCTTTGCCCAGGGCGAGGACCAGCGTTGGACTTTCAAGCCCACTTGGGCT
GAGTAA

Retrieve as FASTA