Entry information : CgloCIIAC01_Naragc5
Entry ID 13176
Creation 2015-04-23 (Christophe Dunand)
Last sequence changes 2015-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-23 (Christophe Dunand)
Peroxidase information: CgloCIIAC01_Naragc5
Name CgloCIIAC01_Naragc5
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum gloeosporioides (Glomerella cingulata)    [TaxId: 5457 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgloCIIAC01_Naragc5
start..stop
S start..stop
CgloCIIAC01_ST23 544 0 1..295 1..295
CfioCIIAC01_MH18 375 2e-131 40..319 37..310
CfioCIIAC_PJ7 374 5e-131 40..319 37..310
GgrCIIAC01 357 4e-124 1..316 1..308
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..442 442 N° 2 499..940 442 N° 3 995..1070 76  
join(1..442,499..940,995..1070)


exon

Literature and cross-references CgloCIIAC01_Naragc5
Literature Gan,P.H.P., Ikeda,K., Irieda,H., Narusaka,M., O'Connell,R.J., Narusaka,Y., Takano,Y., Kubo,Y. and Shirasu,K. Genome analysis of Colletotrichum orbiculare and Colletotrichum gloeosporioides
DNA ref. GenBank:   NW_006762562.1 (46679..45610)
Cluster/Prediction ref. Genebank:   18738614
Protein sequence: CgloCIIAC01_Naragc5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (302)
PWM (Da):   %s   33441.14 (31621.2)  
PI (pH):   %s   5.36 (5.11) Peptide Signal:   %s   cut: 18 range:18-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHASLYLLTSFLALTSAATVDLAPRKGGSDDSGSGSSGKGSSGSNTCSVWTKVNKDLNTRFMAGDQCNDLARAAIRAIFHDCGSWDTTQGFSGGCDGSLILGKSSSAGDPDELFRNENRGLQNIAKVLQDMATQYGTSVADMIVFAGNAAIFLCPGGPKVKTFVGRKDSTANAKPGGLPDVFASASDLFALFQAKGYSAEDLAALLGAHSTSTQNFVDPSQKNASQDSTPGKWDVNYYAETYNYASQAAPKTAPPGVFVFPSDEKLATDTKTDVAAKFQGFIGQQNKWASSFSGAMEKMALFGNDKRTMTDCTDSIARV

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAGCCTCTACCTCCTCACCAGCTTCTTGGCCCTCACCTCCGCGGCCACTGTTGACCTGGCTCCCCGCAAGGGCGGCTCTGATGACAGCGGCTCCGGCTCCAGTGGCAAGGGC
AGCAGCGGCAGCAACACGTGCTCCGTCTGGACCAAGGTCAACAAGGACCTGAACACCCGCTTCATGGCCGGCGACCAGTGCAACGATCTTGCCCGCGCCGCCATTCGTGCCATCTTCCAC
GACTGCGGCTCTTGGGATACCACACAAGGCTTCAGCGGTGGCTGTGACGGTTCTCTGATTCTTGGCAAGAGCTCATCTGCCGGTGACCCCGATGAGCTCTTCAGAAACGAGAACCGCGGC
CTGCAGAACATTGCCAAGGTTCTCCAGGACATGGCCACCCAGTACGGAACATCAGTTGCTGACATGATTGTGTTTGCTGGAA
GTAAGTTACCCCATGGTCGACGACTTGAAGAAGCCTGC
TGAGTCTGATCAACTTAGATGCCGCAATCTTTCTGTGCCCCGGCGGTCCCAAGGTCAAGACCTTCGTCGGCCGCAAGGACTCCACTGCCAACGCCAAGCCTGGCGGTCTCCCAGACGTCT
TTGCCTCCGCGTCCGACCTCTTTGCTCTCTTCCAGGCCAAGGGCTACAGCGCCGAGGACCTTGCCGCTCTTCTTGGCGCTCACAGCACATCAACTCAGAACTTCGTCGACCCCAGCCAGA
AGAACGCATCTCAGGACTCCACCCCCGGCAAGTGGGATGTCAATTACTACGCCGAGACATACAACTACGCCTCTCAGGCCGCTCCCAAGACTGCTCCCCCGGGCGTCTTCGTCTTCCCCT
CTGATGAGAAGCTCGCCACAGACACCAAGACCGATGTTGCCGCCAAGTTCCAGGGCTTCATTGGCCAACAGAACAAGTGGGCTAGCAGCTTTTCCGGCGC
GTAAGTTATTCATCAAGTCC
TGTTTCTACCACAGTTGAGCTAACACGGATTTAGTATGGAAAAGATGGCTCTTTTCGGAAACGACAAGAGGACCATGACTGACTGCACCGACTCCATTGCGAGGGTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGCCAGCCTCTACCTCCTCACCAGCTTCTTGGCCCTCACCTCCGCGGCCACTGTTGACCTGGCTCCCCGCAAGGGCGGCTCTGATGACAGCGGCTCCGGCTCCAGTGGCAAGGGC
AGCAGCGGCAGCAACACGTGCTCCGTCTGGACCAAGGTCAACAAGGACCTGAACACCCGCTTCATGGCCGGCGACCAGTGCAACGATCTTGCCCGCGCCGCCATTCGTGCCATCTTCCAC
GACTGCGGCTCTTGGGATACCACACAAGGCTTCAGCGGTGGCTGTGACGGTTCTCTGATTCTTGGCAAGAGCTCATCTGCCGGTGACCCCGATGAGCTCTTCAGAAACGAGAACCGCGGC
CTGCAGAACATTGCCAAGGTTCTCCAGGACATGGCCACCCAGTACGGAACATCAGTTGCTGACATGATTGTGTTTGCTGGAA
ATGCCGCAATCTTTCTGTGCCCCGGCGGTCCCAAGGTC
AAGACCTTCGTCGGCCGCAAGGACTCCACTGCCAACGCCAAGCCTGGCGGTCTCCCAGACGTCTTTGCCTCCGCGTCCGACCTCTTTGCTCTCTTCCAGGCCAAGGGCTACAGCGCCGAG
GACCTTGCCGCTCTTCTTGGCGCTCACAGCACATCAACTCAGAACTTCGTCGACCCCAGCCAGAAGAACGCATCTCAGGACTCCACCCCCGGCAAGTGGGATGTCAATTACTACGCCGAG
ACATACAACTACGCCTCTCAGGCCGCTCCCAAGACTGCTCCCCCGGGCGTCTTCGTCTTCCCCTCTGATGAGAAGCTCGCCACAGACACCAAGACCGATGTTGCCGCCAAGTTCCAGGGC
TTCATTGGCCAACAGAACAAGTGGGCTAGCAGCTTTTCCGGCGC
TATGGAAAAGATGGCTCTTTTCGGAAACGACAAGAGGACCATGACTGACTGCACCGACTCCATTGCGAGGGTGTAG

Retrieve as FASTA